DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arf51F and Arl4a

DIOPT Version :9

Sequence 1:NP_523751.2 Gene:Arf51F / 36699 FlyBaseID:FBgn0013750 Length:175 Species:Drosophila melanogaster
Sequence 2:NP_062059.1 Gene:Arl4a / 29308 RGDID:2152 Length:200 Species:Rattus norvegicus


Alignment Length:169 Identity:77/169 - (45%)
Similarity:111/169 - (65%) Gaps:6/169 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETV-----TYKNVKFNVWD 63
            :||.:...:...|::||||.|||||:||:|:..:.|.|:||.|||.|.:     ..|.|.|:.||
  Rat    11 ILSSLPSFQSFHIVILGLDCAGKTTVLYRLQFNEFVNTVPTKGFNTEKIKVTLGNSKTVTFHFWD 75

  Fly    64 VGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARTELHRIINDREMRDAIILIFANKQDLPD 128
            ||||:|:||||:.|...|.|::||||..|.:|::||:||||:|....|.:...:||.||||||.:
  Rat    76 VGGQEKLRPLWKSYTRCTDGIVFVVDSVDVERMEEAKTELHKITRISENQGVPVLIVANKQDLRN 140

  Fly   129 AMKPHEIQEKLGLTRIRDRN-WYVQPSCATSGDGLSEGL 166
            ::...||::.|.:..:.... |::||:||..||||.|||
  Rat   141 SLSLSEIEKLLAMGELSSSTPWHLQPTCAIIGDGLKEGL 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arf51FNP_523751.2 P-loop_NTPase 1..174 CDD:422963 77/169 (46%)
Arl4aNP_062059.1 Arl4_Arl7 18..200 CDD:206719 75/162 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D587782at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.