DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arf51F and Arl15

DIOPT Version :9

Sequence 1:NP_523751.2 Gene:Arf51F / 36699 FlyBaseID:FBgn0013750 Length:175 Species:Drosophila melanogaster
Sequence 2:NP_766183.1 Gene:Arl15 / 218639 MGIID:2442308 Length:204 Species:Mus musculus


Alignment Length:154 Identity:54/154 - (35%)
Similarity:83/154 - (53%) Gaps:2/154 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 EMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHY 77
            |..::.:||..:|||::|.:|........:.|.||:::.|.::|...||.::||.|.||..|..|
Mouse    32 EYDLVCIGLTGSGKTSLLSELCSESPENVVSTTGFSIKAVPFQNAVLNVKELGGADNIRKYWSRY 96

  Fly    78 YTGTQGLIFVVDCA-DRDRIDEARTELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGL 141
            |.|:||:|||:|.| ..|.::.||.|||..:...::.....||.||.||.|.|....||::...|
Mouse    97 YQGSQGVIFVLDSASSEDDLETARNELHSALQHPQLCTLPFLILANHQDKPAARSVQEIKKYFEL 161

  Fly   142 TRI-RDRNWYVQPSCATSGDGLSE 164
            ..: |.:.|.:||......|.|.:
Mouse   162 EPLARGKRWILQPCSLDDVDTLKD 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arf51FNP_523751.2 P-loop_NTPase 1..174 CDD:422963 54/154 (35%)
Arl15NP_766183.1 Gem1 31..197 CDD:224025 54/154 (35%)
P-loop_NTPase 34..193 CDD:304359 53/152 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53833
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.