DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arf51F and arl11

DIOPT Version :9

Sequence 1:NP_523751.2 Gene:Arf51F / 36699 FlyBaseID:FBgn0013750 Length:175 Species:Drosophila melanogaster
Sequence 2:XP_002935781.1 Gene:arl11 / 100490310 XenbaseID:XB-GENE-1012125 Length:180 Species:Xenopus tropicalis


Alignment Length:167 Identity:83/167 - (49%)
Similarity:107/167 - (64%) Gaps:1/167 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKLLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTY-KNVKFNVWDV 64
            ||...||....|:.|::|:|||.:||:|||||||:.|.|.|.||||||||.:.. |||...||||
 Frog     1 MGGQNSKPLHKKQPRVVMMGLDYSGKSTILYKLKINQLVETFPTVGFNVEHIEMSKNVSVTVWDV 65

  Fly    65 GGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARTELHRIINDREMRDAIILIFANKQDLPDA 129
            |||||:||.|:.|...|..||||||.:|.||:.:|..||..|:|:..|.....||.|||||:.||
 Frog    66 GGQDKLRPNWKEYLEDTDVLIFVVDSSDPDRLPDATAELLSILNNENMAGVPFLILANKQDITDA 130

  Fly   130 MKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLSEGL 166
            :...|::..|.|....||.|.:|...|.:|:||:|.:
 Frog   131 LPAKELKHILKLENYDDRPWEIQSCSAYTGEGLAEAM 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arf51FNP_523751.2 P-loop_NTPase 1..174 CDD:422963 83/167 (50%)
arl11XP_002935781.1 P-loop_NTPase 15..173 CDD:422963 78/153 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D587782at33208
OrthoFinder 1 1.000 - - FOG0000118
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11711
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.