DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ItgaPS4 and GPLD1

DIOPT Version :9

Sequence 1:NP_611025.2 Gene:ItgaPS4 / 36693 FlyBaseID:FBgn0034005 Length:1069 Species:Drosophila melanogaster
Sequence 2:XP_016866242.1 Gene:GPLD1 / 2822 HGNCID:4459 Length:850 Species:Homo sapiens


Alignment Length:354 Identity:89/354 - (25%)
Similarity:139/354 - (39%) Gaps:100/354 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   184 LADTNLIPYYSMGELGLSAHVSDDNSKLLMGAPGIDQ---WKGSVHLKQEVPSIKTSSGRQRRGM 245
            ||.:.|.|.||.    .|..:.:...:..:|  |:|.   |..:::   .:.|....:|      
Human   233 LAVSKLYPTYST----KSPFLVEQFQEYFLG--GLDDMAFWSTNIY---HLTSFMLENG------ 282

  Fly   246 NTNRKCNECN-PEPKNF----GQEEFSYFGYAVSSGYFDSSNLSTVLYVATAPRGNNQFGEAYIF 305
                 .::|| ||...|    ||:..:. |..:....| ..||:|.| ..:..|..|.......|
Human   283 -----TSDCNLPENPLFIACGGQQNHTQ-GSKMQKNDF-HRNLTTSL-TESVDRNINYTERGVFF 339

  Fly   306 DIYE---DS---IYKYHE------FRG----------NHFGEYF--------GYSVLAEDLNGDG 340
            .:..   ||   |||..|      |.|          :....||        |:::.:.|||.||
Human   340 SVNSWTPDSMSFIYKALERNIRTMFIGGSQLSQKHVSSPLASYFLSFPYARLGWAMTSADLNQDG 404

  Fly   341 KTDVIISAPLYALRNSYDDGAIYVF-------------INKGSFTFEERIIRSPAGSGGRFGTTL 392
            ..|:::.||.|:.......|.:|:.             ::|.:    .||:.....| ||||:.|
Human   405 HGDLVVGAPGYSRPGHIHIGRVYLIYGNDLGLPPVDLDLDKEA----HRILEGFQPS-GRFGSAL 464

  Fly   393 SRIGDINKDGYNDVAVGAPFAGN------GSVFIYLGS-ENGLRDPPS---QCLDAPSQQPSKYG 447
            : :.|.|.||..|:|||||..|:      |:|::|.|| :.|:...|:   .|.|....      
Human   465 A-VLDFNVDGVPDLAVGAPSVGSEQLTYKGAVYVYFGSKQGGMSSSPNITISCQDIYCN------ 522

  Fly   448 SYMFGHGLSRGSDIDGNGFNDFAIGAPNA 476
               .|..| ..:|::|:...|..||:|.|
Human   523 ---LGWTL-LAADVNGDSEPDLVIGSPFA 547

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ItgaPS4NP_611025.2 VCBS 335..408 CDD:290251 25/85 (29%)
Int_alpha 384..434 CDD:214549 24/59 (41%)
Int_alpha 447..>492 CDD:214549 9/30 (30%)
Integrin_alpha2 484..808 CDD:285619
GPLD1XP_016866242.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3637
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7104
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.850

Return to query results.
Submit another query.