DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scb and GPLD1

DIOPT Version :9

Sequence 1:NP_523750.2 Gene:scb / 36692 FlyBaseID:FBgn0286785 Length:1115 Species:Drosophila melanogaster
Sequence 2:XP_016866242.1 Gene:GPLD1 / 2822 HGNCID:4459 Length:850 Species:Homo sapiens


Alignment Length:236 Identity:60/236 - (25%)
Similarity:100/236 - (42%) Gaps:40/236 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   289 DSYFGYAVSSGFF--DSSNPTKLLYVATAPQANKQSGEAYIFDVRGKSIHKYHVFRGEQFGEYF- 350
            |....|.....||  :|..|..:.::..|.:.|.::    :| :.|..:.:.||  ......|| 
Human   327 DRNINYTERGVFFSVNSWTPDSMSFIYKALERNIRT----MF-IGGSQLSQKHV--SSPLASYFL 384

  Fly   351 -------GYSVLAEDLNGDGKTDVIVSAPQHALEDSHDNGAIYVFINKGF--------FNFERQI 400
                   |:::.:.|||.||..|::|.||.::.......|.:|:......        .:.|...
Human   385 SFPYARLGWAMTSADLNQDGHGDLVVGAPGYSRPGHIHIGRVYLIYGNDLGLPPVDLDLDKEAHR 449

  Fly   401 LRSPVETMARFGTALSRLGDINHDGYNDVAVGAPFAGN------GTVFIYLGS-ENGLRDQPSQR 458
            :....:...|||:||:.| |.|.||..|:|||||..|:      |.|::|.|| :.|:...|:..
Human   450 ILEGFQPSGRFGSALAVL-DFNVDGVPDLAVGAPSVGSEQLTYKGAVYVYFGSKQGGMSSSPNIT 513

  Fly   459 LDAPSQQPSKYGSHMFGHGLSRGSDIDGNGFNDFAIGAPNA 499
            :.......:      .|..| ..:|::|:...|..||:|.|
Human   514 ISCQDIYCN------LGWTL-LAADVNGDSEPDLVIGSPFA 547

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scbNP_523750.2 Int_alpha 51..103 CDD:214549
FG-GAP 350..388 CDD:280083 13/45 (29%)
Int_alpha 409..459 CDD:214549 24/56 (43%)
Int_alpha 473..>515 CDD:214549 9/27 (33%)
Integrin_alpha2 507..829 CDD:285619
GPLD1XP_016866242.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3637
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.