DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8079 and AT3G52350

DIOPT Version :9

Sequence 1:NP_611023.1 Gene:CG8079 / 36689 FlyBaseID:FBgn0034002 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_190803.1 Gene:AT3G52350 / 824400 AraportID:AT3G52350 Length:180 Species:Arabidopsis thaliana


Alignment Length:147 Identity:38/147 - (25%)
Similarity:63/147 - (42%) Gaps:33/147 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   466 KYGL--ENEKFVDTSGNGQSNYNDRAATRRVQVGSSTDKEKTEVACVNTEIGSSNKGFKMLSKLG 528
            |.||  :..|..:.|....|:|:::.:.   .:|.|::....     :|.|.|||.||::|.|.|
plant    35 KQGLVIQRRKKTEKSQATISHYSEKVSN---VIGDSSESSNP-----STAISSSNIGFQLLKKHG 91

  Fly   529 WQKGEKLGKTNASAGLLEPINVVANEGTSGLGNSDP---------------VLSSSRTIDKRKLA 578
            |::|..||.|  ..|:|.|:.........|||...|               |...|:.:.| ||.
plant    92 WKEGTGLGIT--EQGILVPLQAEPKHNKQGLGAEKPAKRKPAQPQDTAFEEVSKKSKKLSK-KLV 153

  Fly   579 NL-----KITQARYQRA 590
            .:     ::.:..::||
plant   154 KMIEHEKRLAENEFERA 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8079NP_611023.1 OCRE_VG5Q 124..177 CDD:293883
OCRE repeat 1 129..136 CDD:293883
OCRE repeat 2 137..144 CDD:293883
OCRE repeat 3 145..152 CDD:293883
OCRE repeat 4 153..159 CDD:293883
OCRE repeat 5 162..169 CDD:293883
FHA 346..411 CDD:278899
G-patch 516..560 CDD:279867 17/43 (40%)
AT3G52350NP_190803.1 G-patch 79..123 CDD:279867 19/45 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0154
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.