DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8079 and SON

DIOPT Version :9

Sequence 1:NP_611023.1 Gene:CG8079 / 36689 FlyBaseID:FBgn0034002 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_620305.3 Gene:SON / 6651 HGNCID:11183 Length:2426 Species:Homo sapiens


Alignment Length:304 Identity:64/304 - (21%)
Similarity:117/304 - (38%) Gaps:70/304 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   183 QANDAAKPESE--DEDLEVQFDELGGVITDHETLKK--IKAEKQKAK------DQAEKSKRKAKK 237
            ||.|||.....  :|::..:.:|:...:.|.|...|  :|...:|::      |..::...| |.
Human    45 QAGDAAASARSLPNEEIVQKIEEVLSGVLDTELRYKPDLKEGSRKSRCVSVQTDPTDEIPTK-KS 108

  Fly   238 KKSKKH-SKKRSKKERRHKSKKRHRHSDDERSNDAEEGELSQSSDSSSDSSNEDSS--------- 292
            ||.||| :||:.||:.:.|..||.....:.::...::|.:...|||.....:|.|:         
Human   109 KKHKKHKNKKKKKKKEKEKKYKRQPEESESKTKSHDDGNIDLESDSFLKFDSEPSAVALELPTRA 173

  Fly   293 ---SNTEDSSVPVFKAAGRFQDIAKKYPPSLRIIVQETNV-ESLK--VGSLHLITYKGGSLGREG 351
               |.|.:|...|.:            ||.:.:.|.|.:: |:||  ..:..|.......:..:.
Human   174 FGPSETNESPAVVLE------------PPVVSMEVSEPHILETLKPATKTAELSVVSTSVISEQS 226

  Fly   352 AHDV-IIPDVNVSKCHLKFKYENKLGIYQCLDLGSRNGTILNGSPMSSDAMDLVHGS-VITLG-- 412
            ...| ::|:.:::|....|.                      .:|:.:..:.|.... |:|:.  
Human   227 EQSVAVMPEPSMTKILDSFA----------------------AAPVPTTTLVLKSSEPVVTMSVE 269

  Fly   413 -QTRLLCHVHEGNSTCGLCEPGLLIENSPPVVAAVASSTASVLS 455
             |.:.:....|..|.    ||..::...|||...:..|...|:|
Human   270 YQMKSVLKSVESTSP----EPSKIMLVEPPVAKVLEPSETLVVS 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8079NP_611023.1 OCRE_VG5Q 124..177 CDD:293883
OCRE repeat 1 129..136 CDD:293883
OCRE repeat 2 137..144 CDD:293883
OCRE repeat 3 145..152 CDD:293883
OCRE repeat 4 153..159 CDD:293883
OCRE repeat 5 162..169 CDD:293883
FHA 346..411 CDD:278899 7/66 (11%)
G-patch 516..560 CDD:279867
SONNP_620305.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 24..56 5/10 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 77..155 21/78 (27%)
PHA03247 <170..460 CDD:223021 31/178 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 305..328 2/5 (40%)
PHA03379 <340..673 CDD:223066
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 406..442
17 X 10 AA tandem repeats of L-A-[ST]-[NSG]-[TS]-MDSQM 726..895
MSCRAMM_SdrC <730..903 CDD:380146
11 X 7 AA tandem repeats of [DR]-P-Y-R-[LI][AG][QHP] 912..988
14 X 6 AA repeats of [ED]-R-S-M-M-S 1006..1126
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1144..1236
3 X 11 AA tandem repats of P-P-L-P-P-E-E-P-P-[TME]-[MTG] 1147..1179
rne <1289..1481 CDD:236766
4 X 8 AA tandem repeats of V-L-E-SS-[AVT]-VT 1359..1390
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1645..1722
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1754..2054
7 X 7 AA repeats of P-S-R-R-S-R-[TS] 1925..1994
2 X 19 AA repeats of P-S-R-R-R-R-S-R-S-V-V-R-R-R-S-F-S-I-S 1934..2013
3 X tandem repeats of [ST]-P-[VLI]-R-[RL]-[RK]-[RF]-S-R 2013..2039
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 2200..2220
G-patch 2305..2349 CDD:396249
DSRM_SF 2369..>2419 CDD:412133
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4438
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.