DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8079 and Rbm10

DIOPT Version :9

Sequence 1:NP_611023.1 Gene:CG8079 / 36689 FlyBaseID:FBgn0034002 Length:601 Species:Drosophila melanogaster
Sequence 2:XP_038955950.1 Gene:Rbm10 / 64510 RGDID:631366 Length:930 Species:Rattus norvegicus


Alignment Length:476 Identity:96/476 - (20%)
Similarity:149/476 - (31%) Gaps:185/476 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 NLNNFVYEHTSGMYYDPKTGYYYNAEYGLYYDGNNGCYYSYDHAKDSY--EFHSQAQVQANDAAK 189
            :::.:.|:.|||.||||:||.||:.....||:..:..|..:|..:.:|  .....|....:..|.
  Rat   568 DVSTYQYDETSGYYYDPQTGLYYDPNSQYYYNAQSQQYLYWDGERRTYIPALEQSADGHKDTGAS 632

  Fly   190 PESEDEDLEVQFDELGGVITDHETLKKIKAEKQKAKDQAEKSKRKAKKKKSKKHS---------- 244
            .:...|..|           .|:|    |..:|.|||....::...|:|::.|:|          
  Rat   633 SKEGKEKKE-----------KHKT----KTAQQIAKDMERWARSLNKQKENFKNSFQPISALRDD 682

  Fly   245 ----------------KKRSKKERRHKSKKRHRHSDDERSNDAEEGELSQSSDSSSDSSNEDSSS 293
                            ||.:..||:|.|....:.:.|:|.:.......:.|.:|.|:...|    
  Rat   683 ERRESATADAGYAILEKKGALAERQHTSMDLPKLASDDRPSPPRGLVAAYSGESDSEEEQE---- 743

  Fly   294 NTEDSSVPVFKAAGRFQDIAKKYPPSLRIIVQETNVESLKVGSLHLITYKGGSLGREGAHDVIIP 358
                                                             :||.            
  Rat   744 -------------------------------------------------RGGP------------ 747

  Fly   359 DVNVSKCHLKFKYENKLGIYQCLDLGSRNGTILNGSPMSSDAMDLVHGSVITLGQTRLLCHVHEG 423
                       :.|.||..:|.|                                          
  Rat   748 -----------EREEKLTDWQKL------------------------------------------ 759

  Fly   424 NSTCGLCEPGLLIENSPPVVAAVASSTASVLSHKEQLKKLQRKYGLENE-KFVDTSGNGQSNYND 487
              .|.||.     ...|...|.:.....|.| ||:.|:..:|.:..||| :.::.:...|..|.|
  Rat   760 --ACLLCR-----RQFPSKEALIRHQQLSGL-HKQNLEIHRRAHLSENELEALEKNDMEQMKYRD 816

  Fly   488 RAATRRVQVGSSTDKEK-------TEVACVNTE------IGSSNKGFKMLSKLGWQKGEKLGKTN 539
            |||.||.:.|.....|.       ...|.|:.|      :||.|.|.:||..:||::|..||:  
  Rat   817 RAAERREKYGIPEPPEPKRRKYGGISTASVDFEQPTRDGLGSDNIGSRMLQAMGWKEGSGLGR-- 879

  Fly   540 ASAGLLEPINVVANEGTSGLG 560
            ...|::.||........||||
  Rat   880 KKQGIVTPIEAQTRVRGSGLG 900

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8079NP_611023.1 OCRE_VG5Q 124..177 CDD:293883 17/51 (33%)
OCRE repeat 1 129..136 CDD:293883 1/6 (17%)
OCRE repeat 2 137..144 CDD:293883 5/6 (83%)
OCRE repeat 3 145..152 CDD:293883 4/6 (67%)
OCRE repeat 4 153..159 CDD:293883 2/5 (40%)
OCRE repeat 5 162..169 CDD:293883 1/6 (17%)
FHA 346..411 CDD:278899 5/64 (8%)
G-patch 516..560 CDD:279867 15/43 (35%)
Rbm10XP_038955950.1 RRM 21..>233 CDD:223796
RRM1_RBM10 129..212 CDD:410147
ZnF_RBZ 216..240 CDD:197784
RanBP2-type Zn finger 218..237 CDD:275376
RRM2_RBM10 299..385 CDD:410148
OCRE_RBM10 564..627 CDD:293886 18/58 (31%)
OCRE repeat 1 570..577 CDD:293886 1/6 (17%)
OCRE repeat 2 578..585 CDD:293886 5/6 (83%)
OCRE repeat 3 586..593 CDD:293886 4/6 (67%)
OCRE repeat 4 594..600 CDD:293886 2/5 (40%)
OCRE repeat 5 602..609 CDD:293886 1/6 (17%)
G-patch 858..902 CDD:396249 17/45 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0154
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.