DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8079 and Son

DIOPT Version :9

Sequence 1:NP_611023.1 Gene:CG8079 / 36689 FlyBaseID:FBgn0034002 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_001262426.1 Gene:Son / 41159 FlyBaseID:FBgn0037716 Length:874 Species:Drosophila melanogaster


Alignment Length:552 Identity:113/552 - (20%)
Similarity:202/552 - (36%) Gaps:138/552 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PAEEEDLADTVAKYDSIELKSIQ-DLETCEQQQLLQYVEKLHGIIRKYDTKLASYKQKLLHYVSR 67
            |..:|.||  :.|...|::||.: |.|.                    :.||.:...|:     :
  Fly    23 PPVQEPLA--LTKIPPIKVKSERPDAEV--------------------EAKLRAMNAKI-----K 60

  Fly    68 EEKVSCDKASQATE----SELQECQYSMENDEDTNKK--DQPNDLSATDAFSFVDEMRQAAKHAE 126
            .|.|:..:.|.:.|    .|..|.:.|...|:..|.|  ...|::.| :.|...:    ||...|
  Fly    61 AEMVTLMRRSNSNELGNNDESGESESSASADDKKNIKPVKSSNEILA-ELFGVFN----AAPPEE 120

  Fly   127 NLNNFVYEHTSGMYYDPKTGYYYNAEYGLYYDGNNGCYYSYDHAKDSY--EFHSQAQVQANDAAK 189
            .|::.:::....:..:.|.   ..|:.......:..|..|....|..:  :.|....::..|..|
  Fly   121 LLDDNLFKKKKKVKKEKKD---KKAKKKKTTKSDGECSDSEAEGKHKHKRKKHKHKDIRVKDKEK 182

  Fly   190 PESEDEDLEVQFDELGGVITD--HETLKKIKAEKQKAKDQAEKSKRKAKKKKSKKHSKKRSKKER 252
            ....|:..|...|.    :||  .|..:....::.|:||:...::..::|:|.|..|:|||..|.
  Fly   183 DRDRDKSKEKDRDR----VTDKSKEKDRDRDRDRDKSKDKFTAAQAPSEKEKEKSESRKRSAVEP 243

  Fly   253 RHKSKKRHRHS-----DDERSNDAE---EGELSQSSDSSSDSSNE-DSSSNTEDSSVPVFKAAGR 308
            ...|:||.||.     |.||..:.|   |.|..:|::|..:...| |....:|.:|.   |:.  
  Fly   244 SSHSEKRERHEREKHRDWEREREREKEHERERVRSNNSFYNGQREADRLKGSESAST---KSR-- 303

  Fly   309 FQDIAKKYPPSLRIIVQETNVESLKVGSLHLITYKGGSLGREGAHD---------VIIPDVNVSK 364
                            ||.::..:.:........:..|.||..||:         .:.|..||.:
  Fly   304 ----------------QEQDLSDISLSDEESYLREKASNGRRRAHNSFYDEKEELSVSPKRNVRE 352

  Fly   365 CHLKFKYENK-----LGI--YQCLDLGSRN-------GTILNGSPMSSDAMDLV-----HGSVIT 410
            .:.:...:::     |||  .:.|::..||       ||:...:.|:::..|.|     :|....
  Fly   353 SNTRRNRKSRSRSRDLGIDKKRLLEIARRNAINMFKQGTMPGVANMTAEVKDKVLVKMRYGGRTI 417

  Fly   411 LGQTRLLCHVHEGNSTCGLC-----------------EPGLLIENSPPVVAAVASSTASVLSH-- 456
            ...|.....:..|:....|.                 .|..|.|.. |:|..:.:|||.|.:.  
  Fly   418 QDLTDFCKKISNGDGLSDLSSEEESDVDKNGNAKVFHHPFQLKERE-PIVMHIRNSTALVPAPPR 481

  Fly   457 -KEQLKKLQRKYGLENEKFVDTSGNGQSNYND 487
             .||.|.:..::.:         .:||::.|:
  Fly   482 LDEQTKAITMQFPV---------SSGQTHRNN 504

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8079NP_611023.1 OCRE_VG5Q 124..177 CDD:293883 7/54 (13%)
OCRE repeat 1 129..136 CDD:293883 0/6 (0%)
OCRE repeat 2 137..144 CDD:293883 0/6 (0%)
OCRE repeat 3 145..152 CDD:293883 0/6 (0%)
OCRE repeat 4 153..159 CDD:293883 0/5 (0%)
OCRE repeat 5 162..169 CDD:293883 2/6 (33%)
FHA 346..411 CDD:278899 20/92 (22%)
G-patch 516..560 CDD:279867
SonNP_001262426.1 PHA03247 <455..627 CDD:223021 15/60 (25%)
G-patch 705..747 CDD:396249
DSRM_SON-like 798..872 CDD:380699
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4438
SonicParanoid 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.