DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8079 and Gpatch2l

DIOPT Version :9

Sequence 1:NP_611023.1 Gene:CG8079 / 36689 FlyBaseID:FBgn0034002 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_001128031.1 Gene:Gpatch2l / 314325 RGDID:1308907 Length:474 Species:Rattus norvegicus


Alignment Length:438 Identity:82/438 - (18%)
Similarity:136/438 - (31%) Gaps:162/438 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 IQDL-----ETCEQQQLLQYVEKLHGIIRKYDTKLASY--KQKLLHYVSREEKVSCDKASQATES 82
            :.||     :|.||.:|.:..|::....|:...:|...  :::...:....|...|  .|:|:||
  Rat     5 VHDLASALEQTSEQSKLGELWEEMALSPRQQRRQLRKRRGRKRRSDFTHLAEHACC--FSEASES 67

  Fly    83 ELQECQYSMENDEDTNKKDQPNDLSATDAFSFVDEMRQAAKHAENLNNFVYEHTSGMYYDPKTGY 147
            .|         ||.|  || ..:::....||..|:...|.:|.. |:..|               
  Rat    68 SL---------DEAT--KD-CREVAPLTNFSDSDDTVVAKRHPA-LSAIV--------------- 104

  Fly   148 YYNAEYGLYYDGNNGCYYSYDHAKDSYEFHSQAQVQANDAAKPESEDEDLEVQFDELGGVITDHE 212
                         .|..:|: |..||:        ..|...:|                 :....
  Rat   105 -------------RGKQHSW-HESDSF--------TENAPCRP-----------------LRRRR 130

  Fly   213 TLKKIKAE-----KQKAKDQAEKSKRKAKKKKSKKHS---------------------------K 245
            .:|::.:|     :||.|......:|..:.|.:||..                           .
  Rat   131 KVKRVASEVAASLQQKLKVSDWSYERGCRFKSAKKQRLSRWKENTPWTSSGHGLCESAESRTFLS 195

  Fly   246 KRSKKERRHKSKKRHRHSDDERSNDAEEGELSQSSDSSSDSSNEDSSSNTEDSS-------VPVF 303
            |..:|||.....:..:|..||..:::|...:..|||:...:::|....:.|.|.       ||.|
  Rat   196 KTGRKERMECEAEGQKHGSDENMSESETSSVCSSSDTGLFTNDEGRQGDDEQSDWFYEGECVPGF 260

  Fly   304 KAAGRFQDIAKKYPPSLRIIVQETNVESLKVG------SLHLITYKGGSLGREGAHDVIIPDVNV 362
            ..    .::..|:.|.     ..|.||.:..|      |..|:..:....|..|.          
  Rat   261 TV----HNLLPKWAPD-----HCTEVERMDSGLDKLSDSTFLLPSRPAQRGYHGR---------- 306

  Fly   363 SKCHLKFKYENKL--GIYQCLDLGSRN-----------GTILNGSPMS 397
                     .|:|  ...:||..|.|.           ||...|.|:|
  Rat   307 ---------LNRLPGAAARCLRKGRRRLAGKETGISSLGTERIGHPVS 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8079NP_611023.1 OCRE_VG5Q 124..177 CDD:293883 8/52 (15%)
OCRE repeat 1 129..136 CDD:293883 1/6 (17%)
OCRE repeat 2 137..144 CDD:293883 0/6 (0%)
OCRE repeat 3 145..152 CDD:293883 0/6 (0%)
OCRE repeat 4 153..159 CDD:293883 0/5 (0%)
OCRE repeat 5 162..169 CDD:293883 2/6 (33%)
FHA 346..411 CDD:278899 13/65 (20%)
G-patch 516..560 CDD:279867
Gpatch2lNP_001128031.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0154
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.