DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8079 and SPCC1442.13c

DIOPT Version :9

Sequence 1:NP_611023.1 Gene:CG8079 / 36689 FlyBaseID:FBgn0034002 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_588327.3 Gene:SPCC1442.13c / 2539327 PomBaseID:SPCC1442.13c Length:187 Species:Schizosaccharomyces pombe


Alignment Length:104 Identity:27/104 - (25%)
Similarity:44/104 - (42%) Gaps:17/104 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   462 KLQRKYGLENEKFVDTSGNGQSNYNDRAATRRVQVGSSTDKEKTEVACVNTEIGSS------NKG 520
            ||.:|   ...|.|:.:..|...      .:|||:...:....|:.......:|||      .||
pombe    94 KLSKK---RKSKLVEMTPKGLKK------RKRVQIQEGSVSTNTKKRMDGHVVGSSAPAINNGKG 149

  Fly   521 FKMLSKLGWQKGEKLGKTNASAGLLEPINVVANEGTSGL 559
            .::|..:||.:|:.||..|  .|:::|:..|......||
pombe   150 KQLLEMMGWSRGKGLGSEN--QGMVDPVVAVVKNNKQGL 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8079NP_611023.1 OCRE_VG5Q 124..177 CDD:293883
OCRE repeat 1 129..136 CDD:293883
OCRE repeat 2 137..144 CDD:293883
OCRE repeat 3 145..152 CDD:293883
OCRE repeat 4 153..159 CDD:293883
OCRE repeat 5 162..169 CDD:293883
FHA 346..411 CDD:278899
G-patch 516..560 CDD:279867 16/50 (32%)
SPCC1442.13cNP_588327.3 G_patch 145..186 CDD:197727 12/42 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0154
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4438
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.