DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8079 and Rbm6

DIOPT Version :9

Sequence 1:NP_611023.1 Gene:CG8079 / 36689 FlyBaseID:FBgn0034002 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_035381.2 Gene:Rbm6 / 19654 MGIID:1338037 Length:1118 Species:Mus musculus


Alignment Length:513 Identity:106/513 - (20%)
Similarity:165/513 - (32%) Gaps:191/513 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 DTNKKDQPNDLSATDAFSFVDEMRQAAKHAENLNNFVYEHTSGMYYDPKTGYYYNAEYGLYYDGN 160
            |||::.|.   |::|.                   ::|:.|:|.||||..        |.|||.|
Mouse   774 DTNRQGQQ---SSSDC-------------------YIYDSTTGYYYDPLA--------GTYYDPN 808

  Fly   161 NGCYYSYDHAKDSYEFHSQAQVQANDAAKPESEDEDLEVQFDELGGVITDHETLKKIKAEKQKAK 225
                             :|.:|..  ...|||.||:                   :||       
Mouse   809 -----------------TQQEVYV--PQDPESPDEE-------------------EIK------- 828

  Fly   226 DQAEKSKRKAKKKKSKKHSKKRSKKERRHKSKKRHRHSDDERSNDAEEGELSQSSDSSSDSSNED 290
               ||......|..|||.:.||..||::.:...:.:.|..|.....|:                 
Mouse   829 ---EKKSTSQGKSNSKKETSKRDGKEKKDRGMTKFQESTSEGKPPLED----------------- 873

  Fly   291 SSSNTEDSSVPVFKAAGRFQDIAKKYPPSLRIIVQETNVESLKVGS--LHLI-TYKGGSLGREGA 352
                       |||         |..||:::   :|.:....||.:  :.|: .|.|.|...|..
Mouse   874 -----------VFK---------KPLPPTVK---KEESPPPPKVVNPLIGLLGEYGGDSDYEEEE 915

  Fly   353 HDVIIPDVNVSKCH-----LKFKYE-------NKLGIYQCLDLGSRNGTILNGSPMSSDAMDLVH 405
            .:...|.|......     .|.:.|       |||....|                   .....:
Mouse   916 EEEQAPPVQPRTAQPREEMTKKENEDDKLTDWNKLACLLC-------------------RRQFPN 961

  Fly   406 GSVITLGQTRLLCHVHEGNSTCGLCEPGLLIENSPPVVAAVASSTASVLSHKEQLKKLQRKYGLE 470
            ..|:|..|.  |..:|:.|         |.|..             .:...:::|..|:|:   |
Mouse   962 KEVLTKHQQ--LSDLHKQN---------LEIHR-------------KIKQSEQELAYLERR---E 999

  Fly   471 NEKFVDTSGNGQS---NYNDRAATRRVQVGSSTDKEKTEVACVNTEIGSSNKGFKMLSKLGWQKG 532
            .|......||.:.   ...|....:|::....||.::..|...:|:  :|:||.......||:||
Mouse  1000 REGRFKEKGNDRREKLQSFDSPERKRIKYSRETDSDRNPVDKEDTD--TSSKGGCAQQATGWRKG 1062

  Fly   533 EKLGKTNASAGLLEPINVVANEG-TSGLGNSDPVLSSSRTIDKR-KLANLKITQARYQ 588
            ..||.::...|..|.|     || ..|.|...|..:|.|..::. :.|..::..|||:
Mouse  1063 AGLGYSHPGLGSSEEI-----EGRMRGPGGGPPGRTSKRQSNETYRDAVRRVMFARYK 1115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8079NP_611023.1 OCRE_VG5Q 124..177 CDD:293883 12/52 (23%)
OCRE repeat 1 129..136 CDD:293883 1/6 (17%)
OCRE repeat 2 137..144 CDD:293883 4/6 (67%)
OCRE repeat 3 145..152 CDD:293883 0/6 (0%)
OCRE repeat 4 153..159 CDD:293883 3/5 (60%)
OCRE repeat 5 162..169 CDD:293883 0/6 (0%)
FHA 346..411 CDD:278899 11/76 (14%)
G-patch 516..560 CDD:279867 15/44 (34%)
Rbm6NP_035381.2 Pentapeptide_4 173..235 CDD:404485
RRM1_RBM6 456..533 CDD:409753
RRM2_RBM6 651..737 CDD:409979
OCRE_RBM6 763..828 CDD:293882 25/121 (21%)
OCRE repeat 1 769..776 CDD:293882 1/1 (100%)
OCRE repeat 2 785..792 CDD:293882 2/25 (8%)
OCRE repeat 3 793..800 CDD:293882 4/6 (67%)
OCRE repeat 4 801..807 CDD:293882 3/13 (23%)
OCRE repeat 5 811..818 CDD:293882 1/8 (13%)
G-patch 1046..>1079 CDD:396249 12/37 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0154
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.