DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG8079 and si:ch211-161c3.6

DIOPT Version :9

Sequence 1:	NP_611023.1	Gene:	CG8079 / 36689	FlyBaseID:	FBgn0034002	Length:	601	Species:	Drosophila melanogaster
Sequence 2:	NP_001373672.1	Gene:	si:ch211-161c3.6 / 100334833	ZFINID:	ZDB-GENE-131126-51	Length:	111	Species:	Danio rerio

Alignment Length:	111	Identity:	23/111 - (20%)
Similarity:	42/111 - (37%)	Gaps:	28/111 - (25%)

- Green bases have known domain annotations that are detailed below.

  Fly   199 VQFDELG-GVITDHETLKKIKAEKQKA-KDQAEKS--------KRKAKKKKSKKHSKKRSKKERR 253
            :..:|.| |.:.:....|:.:...:|| ::..|.|        .|.:|.|..:..::....||||
Zfish     1 MDMEESGAGQMEETAAPKRSRGRPRKAPQEPVEPSAPRRPRGRPRGSKNKGQRLTTRDEPPKERR 65

  Fly   254 HKSKKR----------HRHSDDERSNDAEE--------GELSQSSD 281
            .:.:.|          .:.::||.....||        .|..:.||
Zfish    66 PRGRPRKWPQKTVQQEEQKAEDEGVESVEEPPTQAPPTAETFEESD 111

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID
CG8079	NP_611023.1	OCRE_VG5Q	124..177	CDD:293883
		OCRE repeat 1	129..136	CDD:293883
		OCRE repeat 2	137..144	CDD:293883
		OCRE repeat 3	145..152	CDD:293883
		OCRE repeat 4	153..159	CDD:293883
		OCRE repeat 5	162..169	CDD:293883
		FHA	346..411	CDD:278899
		G-patch	516..560	CDD:279867
si:ch211-161c3.6	NP_001373672.1	None
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG0154
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.900