DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL41 and MRPL27

DIOPT Version :9

Sequence 1:NP_611022.2 Gene:mRpL41 / 36688 FlyBaseID:FBgn0034001 Length:166 Species:Drosophila melanogaster
Sequence 2:NP_009841.1 Gene:MRPL27 / 852585 SGDID:S000000486 Length:146 Species:Saccharomyces cerevisiae


Alignment Length:117 Identity:32/117 - (27%)
Similarity:50/117 - (42%) Gaps:15/117 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 NKRGTRVVKEAQKTLANPPVAIHKRGVRDTGI---LVDGQYVEIPEKIPDIIVPDLTGCKLKPYV 99
            |||.....|:..||:        .:|.|.:||   ...|.||...:|:...:.||:...:|||||
Yeast    38 NKRVPLTTKQGNKTM--------YKGTRASGIGRHTKFGGYVINWKKVRTYVTPDMVNFELKPYV 94

  Fly   100 SYKAPDVVQSEFTSLD---LFNAVYSQKIIEDFKAGKLQKDGSAKEPSVNEQ 148
            :...|. ::.||....   |...:...||.|....|::|.:|:.......|:
Yeast    95 NANVPP-LKHEFKGFSGGPLDPRLQLLKIKEYIVNGRVQSEGATDTSCYKER 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL41NP_611022.2 MRP-L27 28..149 CDD:286847 32/117 (27%)
MRPL27NP_009841.1 MRP-L27 35..131 CDD:286847 29/101 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4756
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003196
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102880
Panther 1 1.100 - - LDO PTHR21338
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2760
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.