DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL41 and AT5G40080

DIOPT Version :10

Sequence 1:NP_611022.2 Gene:mRpL41 / 36688 FlyBaseID:FBgn0034001 Length:166 Species:Drosophila melanogaster
Sequence 2:NP_198824.1 Gene:AT5G40080 / 834005 AraportID:AT5G40080 Length:94 Species:Arabidopsis thaliana


Alignment Length:98 Identity:32/98 - (32%)
Similarity:44/98 - (44%) Gaps:23/98 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 QQRTISTSSVLEGKRNFRKFNAYNKRGTRVVKEAQKTLANPPVAIHKRGVRDTGILVDGQYVEIP 79
            :::..|:..:|..||..|.|  |..:..:            |...|.|         .|.||..|
plant    16 RRKRASSLDILSPKRAPRDF--YKGKNCK------------PTGFHTR---------KGGYVVQP 57

  Fly    80 EKIPDIIVPDLTGCKLKPYVSYKAPDVVQSEFT 112
            :|:|:.:||||||.|||||||.....|..:|.|
plant    58 DKLPNYVVPDLTGFKLKPYVSQCPLQVNTNEST 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL41NP_611022.2 MRP-L27 28..149 CDD:286847 30/85 (35%)
AT5G40080NP_198824.1 MRP-L27 18..>78 CDD:286847 27/82 (33%)

Return to query results.
Submit another query.