DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL41 and AT5G39800

DIOPT Version :9

Sequence 1:NP_611022.2 Gene:mRpL41 / 36688 FlyBaseID:FBgn0034001 Length:166 Species:Drosophila melanogaster
Sequence 2:NP_568574.1 Gene:AT5G39800 / 833976 AraportID:AT5G39800 Length:94 Species:Arabidopsis thaliana


Alignment Length:98 Identity:32/98 - (32%)
Similarity:44/98 - (44%) Gaps:23/98 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 QQRTISTSSVLEGKRNFRKFNAYNKRGTRVVKEAQKTLANPPVAIHKRGVRDTGILVDGQYVEIP 79
            :::..|:..:|..||..|.|  |..:..:            |...|.|         .|.||..|
plant    16 RRKRSSSLDILSPKRAPRDF--YKGKNCK------------PTGFHTR---------KGGYVVQP 57

  Fly    80 EKIPDIIVPDLTGCKLKPYVSYKAPDVVQSEFT 112
            :|:|:.:||||||.|||||||.....|..:|.|
plant    58 DKLPNYVVPDLTGFKLKPYVSQCPIQVNTNEST 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL41NP_611022.2 MRP-L27 28..149 CDD:286847 30/85 (35%)
AT5G39800NP_568574.1 MRP-L27 26..>78 CDD:286847 26/74 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4756
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1294210at2759
OrthoFinder 1 1.000 - - FOG0003196
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102880
Panther 1 1.100 - - LDO PTHR21338
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3098
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.820

Return to query results.
Submit another query.