DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL41 and mrpl41

DIOPT Version :9

Sequence 1:NP_611022.2 Gene:mRpL41 / 36688 FlyBaseID:FBgn0034001 Length:166 Species:Drosophila melanogaster
Sequence 2:NP_001018603.1 Gene:mrpl41 / 553805 ZFINID:ZDB-GENE-050522-200 Length:135 Species:Danio rerio


Alignment Length:96 Identity:35/96 - (36%)
Similarity:48/96 - (50%) Gaps:2/96 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 AQKTLANPPVAIHK-RGVRDTGILVDG-QYVEIPEKIPDIIVPDLTGCKLKPYVSYKAPDVVQSE 110
            |:.|....|...:| ||.|.|||:... :::.|...||:..||:|.|..||.|||||.|...:..
Zfish    19 AEWTSKRGPRTFYKSRGARPTGIVTSSRKFIPIRAMIPEFAVPNLEGFNLKAYVSYKTPAGTEEP 83

  Fly   111 FTSLDLFNAVYSQKIIEDFKAGKLQKDGSAK 141
            .|...|||.|.:.:|..|.:.|...:|...|
Zfish    84 MTPEKLFNEVVAPQIQRDIEEGVFSEDNLEK 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL41NP_611022.2 MRP-L27 28..149 CDD:286847 35/96 (36%)
mrpl41NP_001018603.1 MRP-L27 13..125 CDD:286847 35/96 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586203
Domainoid 1 1.000 57 1.000 Domainoid score I10935
eggNOG 1 0.900 - - E1_KOG4756
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I5429
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1294210at2759
OrthoFinder 1 1.000 - - FOG0003196
OrthoInspector 1 1.000 - - oto40118
orthoMCL 1 0.900 - - OOG6_102880
Panther 1 1.100 - - LDO PTHR21338
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3098
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1312.760

Return to query results.
Submit another query.