DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL41 and mrpl41

DIOPT Version :9

Sequence 1:NP_611022.2 Gene:mRpL41 / 36688 FlyBaseID:FBgn0034001 Length:166 Species:Drosophila melanogaster
Sequence 2:NP_001016279.1 Gene:mrpl41 / 549033 XenbaseID:XB-GENE-5760540 Length:135 Species:Xenopus tropicalis


Alignment Length:121 Identity:41/121 - (33%)
Similarity:57/121 - (47%) Gaps:29/121 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 NAYNKRGTRVVKEAQKTLANPPVAIHKRGVRDTGILV-DGQYVEIPEKIPDIIVPDLTGCKLKPY 98
            |:|||                     .||.:..|.|. .|::|::.|.:|..:||||||.|||||
 Frog    28 NSYNK---------------------GRGAKKIGYLTSSGKFVKVREMVPAFVVPDLTGFKLKPY 71

  Fly    99 VSYKAPDVVQSEFTSLDLFNAVYSQKIIEDFKAG-----KLQKDGSAKEPSVNEQL 149
            |||:||...:...|...||......:|.:|.:.|     :|||.|.  ||:...:|
 Frog    72 VSYRAPPGSEEPMTPKKLFMETAGPQIEKDLQGGTFRLEELQKYGF--EPTQEGKL 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL41NP_611022.2 MRP-L27 28..149 CDD:286847 40/119 (34%)
mrpl41NP_001016279.1 MRP-L27 13..125 CDD:286847 40/119 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 60 1.000 Domainoid score I10434
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 60 1.000 Inparanoid score I5224
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1294210at2759
OrthoFinder 1 1.000 - - FOG0003196
OrthoInspector 1 1.000 - - oto105335
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2760
SonicParanoid 1 1.000 - - X3098
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.090

Return to query results.
Submit another query.