DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL41 and RGD1560917

DIOPT Version :9

Sequence 1:NP_611022.2 Gene:mRpL41 / 36688 FlyBaseID:FBgn0034001 Length:166 Species:Drosophila melanogaster
Sequence 2:XP_003750600.1 Gene:RGD1560917 / 501028 RGDID:1560917 Length:134 Species:Rattus norvegicus


Alignment Length:135 Identity:42/135 - (31%)
Similarity:67/135 - (49%) Gaps:18/135 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 TISTSSVLEGKRNFRKFNAYNKRGTRVVKEAQKTLANPPVAIHKRGVRDTGILVDGQYVEIPEKI 82
            |..|..::.|.....|:.  :|:|.|...::             ||.:.||...:.::|:|.|.:
  Rat     5 TAVTQGLVRGADRMSKWT--SKQGPRTFTKS-------------RGAKKTGFYTNRKFVQIKEMV 54

  Fly    83 PDIIVPDLTGCKLKPYVSYKAPDVVQSEFTSLDLFNAVYSQKIIEDFKAGKLQKDGSAK---EPS 144
            |:.:||||||.||||||:|:||..:.:..|:..||....:..|.:|||.|....:...|   ||:
  Rat    55 PEFVVPDLTGFKLKPYVNYRAPAGIDTPLTAKALFLETVAPAIEKDFKEGTFDTNNLEKYGFEPT 119

  Fly   145 VNEQL 149
            ...:|
  Rat   120 QEGKL 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL41NP_611022.2 MRP-L27 28..149 CDD:286847 38/123 (31%)
RGD1560917XP_003750600.1 MRP-L27 13..124 CDD:286847 39/125 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345175
Domainoid 1 1.000 69 1.000 Domainoid score I9409
eggNOG 1 0.900 - - E1_KOG4756
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 69 1.000 Inparanoid score I5227
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1294210at2759
OrthoFinder 1 1.000 - - FOG0003196
OrthoInspector 1 1.000 - - otm46328
orthoMCL 1 0.900 - - OOG6_102880
Panther 1 1.100 - - O PTHR21338
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3098
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.760

Return to query results.
Submit another query.