DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL41 and SPAC3A12.19

DIOPT Version :9

Sequence 1:NP_611022.2 Gene:mRpL41 / 36688 FlyBaseID:FBgn0034001 Length:166 Species:Drosophila melanogaster
Sequence 2:NP_001018233.1 Gene:SPAC3A12.19 / 3361547 PomBaseID:SPAC3A12.19 Length:93 Species:Schizosaccharomyces pombe


Alignment Length:61 Identity:19/61 - (31%)
Similarity:22/61 - (36%) Gaps:20/61 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 RGTRVVKEAQKTLANPPVAIHKRGVRDTGILVDGQYVEIPEKIPDIIVPDLTGCKLKPYVS 100
            :|||..|..|||             |..|.||....|.       ..||....|:|.|:||
pombe    25 KGTRTGKMGQKT-------------RHGGFLVQWSRVR-------TFVPPSGDCELLPFVS 65

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL41NP_611022.2 MRP-L27 28..149 CDD:286847 19/61 (31%)
SPAC3A12.19NP_001018233.1 MRP-L27 9..>72 CDD:286847 19/61 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4756
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003196
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102880
Panther 1 1.100 - - LDO PTHR21338
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2760
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.