DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL41 and mrpl-41

DIOPT Version :9

Sequence 1:NP_611022.2 Gene:mRpL41 / 36688 FlyBaseID:FBgn0034001 Length:166 Species:Drosophila melanogaster
Sequence 2:NP_493695.1 Gene:mrpl-41 / 173415 WormBaseID:WBGene00015185 Length:180 Species:Caenorhabditis elegans


Alignment Length:110 Identity:32/110 - (29%)
Similarity:52/110 - (47%) Gaps:23/110 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 GKRNFRKFN--AYNKRGTRVVKEAQKTLANPPVAIHKRGVRDTGILVD-------GQYVEIPEKI 82
            |..|:.||.  ..|:....:..:.||.   .|..:|    |.||:..|       |::|.:.|..
 Worm    37 GPMNYEKFKWPGQNREFPELSPKFQKL---NPKELH----RYTGVQADGFHDEKTGEFVPVKEMR 94

  Fly    83 PDIIVPDLTGCKLKPYVSYKAPDVVQSEFTSLDLFNAVYSQKIIE 127
            .:::||:|.|.||:|||||:. ||      .::.....|.:|::|
 Worm    95 SELVVPNLDGFKLRPYVSYRT-DV------QIEKRRVAYEKKVLE 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL41NP_611022.2 MRP-L27 28..149 CDD:286847 31/109 (28%)
mrpl-41NP_493695.1 MRP-L27 57..>115 CDD:286847 22/64 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162122
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4756
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1294210at2759
OrthoFinder 1 1.000 - - FOG0003196
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102880
Panther 1 1.100 - - LDO PTHR21338
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2760
SonicParanoid 1 1.000 - - X3098
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.780

Return to query results.
Submit another query.