DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL41 and Mrpl41

DIOPT Version :9

Sequence 1:NP_611022.2 Gene:mRpL41 / 36688 FlyBaseID:FBgn0034001 Length:166 Species:Drosophila melanogaster
Sequence 2:NP_001026978.2 Gene:Mrpl41 / 107733 MGIID:1333816 Length:135 Species:Mus musculus


Alignment Length:136 Identity:45/136 - (33%)
Similarity:68/136 - (50%) Gaps:19/136 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 TISTSSVLEGKRNFRKFNAYNKRGTRVVKEAQKTLANPPVAIHKRGVRDTGILV-DGQYVEIPEK 81
            |..|..::.|.....|:.  :|||.|...::             ||.:.|||.. |.::|:|.|.
Mouse     5 TAVTQGLVRGADRMSKWT--SKRGPRTFTKS-------------RGAKKTGIYTSDRKFVQIKEM 54

  Fly    82 IPDIIVPDLTGCKLKPYVSYKAPDVVQSEFTSLDLFNAVYSQKIIEDFKAGKLQKDGSAK---EP 143
            :|:.:||||||.||||||:|:||..:.:..|:..||....:..|.:|||.|....:...|   ||
Mouse    55 VPEFVVPDLTGFKLKPYVNYRAPAGIDTPLTAKALFQETVAPAIEKDFKEGTFDANNLEKYGFEP 119

  Fly   144 SVNEQL 149
            :...:|
Mouse   120 TQEGKL 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL41NP_611022.2 MRP-L27 28..149 CDD:286847 41/124 (33%)
Mrpl41NP_001026978.2 MRP-L27 13..125 CDD:286847 42/126 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841796
Domainoid 1 1.000 69 1.000 Domainoid score I9623
eggNOG 1 0.900 - - E1_KOG4756
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 69 1.000 Inparanoid score I5317
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003196
OrthoInspector 1 1.000 - - oto95149
orthoMCL 1 0.900 - - OOG6_102880
Panther 1 1.100 - - LDO PTHR21338
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2760
SonicParanoid 1 1.000 - - X3098
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.780

Return to query results.
Submit another query.