DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11808 and DOCK4

DIOPT Version :9

Sequence 1:NP_611021.1 Gene:CG11808 / 36687 FlyBaseID:FBgn0034000 Length:219 Species:Drosophila melanogaster
Sequence 2:XP_016868308.1 Gene:DOCK4 / 9732 HGNCID:19192 Length:2006 Species:Homo sapiens


Alignment Length:172 Identity:42/172 - (24%)
Similarity:53/172 - (30%) Gaps:65/172 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 PSRSSRQVSKPKKKKAKKSKKYSRRSRSSSRSTSRSSSS----------SRSSSRSTHSKSRT-- 90
            |.||  .:|.|...:...|...|:.|...|..|.:|.||          |.||..||||.|..  
Human  1668 PRRS--PLSYPAVNRYSSSSLSSQASAEVSNITGQSESSDEVFNMQPSPSTSSLSSTHSASPNVT 1730

  Fly    91 -------------RDHHKSRSISQRKTRGPSSESNSRSATTPAAAPVKAIDLFDTKVQK------ 136
                         .|.||              .|...|..:|...|..||  :.|.|:.      
Human  1731 SSAPSSARASPLLSDKHK--------------HSRENSCLSPRERPCSAI--YPTPVEPSQRMLF 1779

  Fly   137 ------ALETIDEDTFKPE----------SFFSSRDSKETSD 162
                  ||...|.:...||          |..|.:::|..||
Human  1780 NHIGDGALPRSDPNLSAPEKAVNPTPSSWSLDSGKEAKNMSD 1821



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1358
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.