DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11808 and RPL8A

DIOPT Version :9

Sequence 1:NP_611021.1 Gene:CG11808 / 36687 FlyBaseID:FBgn0034000 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_011830.1 Gene:RPL8A / 856352 SGDID:S000001025 Length:256 Species:Saccharomyces cerevisiae


Alignment Length:205 Identity:44/205 - (21%)
Similarity:74/205 - (36%) Gaps:46/205 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 PSRS-SRQVSKPKKKKAKKSKK-YSRRSRSSSRSTSRSSSSSRSSSRSTHSKSRTRDHHKSRSIS 100
            |.|: ||.|..|:..:.::.|| .|.|.:..........:..|:::..|.   :..:.::..:.:
Yeast    42 PKRNLSRYVKWPEYVRVQRQKKILSIRLKVPPTIAQFQYTLDRNTAAETF---KLFNKYRPETAA 103

  Fly   101 QRKTR-----GPSSESNSRSATTPAAAPVK-----AIDLFDTKVQK-ALETIDEDTFKPESFFSS 154
            ::|.|     ...:|..|:...:|....||     .:.|.:.|..| .|...|.|..:...|..:
Yeast   104 EKKERLTKEAAAVAEGKSKQDASPKPYAVKYGLNHVVALIENKKAKLVLIANDVDPIELVVFLPA 168

  Fly   155 RDSKETSDKVIID--------LNNETVTVASKPATAVRNEDVIFHPNFLGDPDMKAEKWLRKLY- 210
            ...|......|:.        :|.:|..||:  .|.||.||               |..|.||. 
Yeast   169 LCKKMGVPYAIVKGKARLGTLVNQKTSAVAA--LTEVRAED---------------EAALAKLVS 216

  Fly   211 ----NYRQKY 216
                |:..||
Yeast   217 TIDANFADKY 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11808NP_611021.1 None
RPL8ANP_011830.1 PTZ00365 2..251 CDD:240382 44/205 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1358
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.