powered by:
Protein Alignment CG11808 and NHP2
DIOPT Version :9
Sequence 1: | NP_611021.1 |
Gene: | CG11808 / 36687 |
FlyBaseID: | FBgn0034000 |
Length: | 219 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_010073.2 |
Gene: | NHP2 / 851319 |
SGDID: | S000002367 |
Length: | 156 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 60 |
Identity: | 14/60 - (23%) |
Similarity: | 23/60 - (38%) |
Gaps: | 16/60 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 125 KAIDLFDTKVQKALETIDEDTFKPESFFSSRDSKETSDKVIIDLNNETVTVASKPATAVR 184
|.:|.::.::...| .|.....||:.:.||: :||..|||.....|
Yeast 15 KTVDNYEARMPAVL-----------PFAKPLASKKLNKKVL-----KTVKKASKAKNVKR 58
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG11808 | NP_611021.1 |
None |
NHP2 | NP_010073.2 |
Rpl7Ae |
30..143 |
CDD:224277 |
11/34 (32%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG1358 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.