DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11808 and AT4G22380

DIOPT Version :10

Sequence 1:NP_611021.1 Gene:CG11808 / 36687 FlyBaseID:FBgn0034000 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_193969.1 Gene:AT4G22380 / 828333 AraportID:AT4G22380 Length:128 Species:Arabidopsis thaliana


Alignment Length:34 Identity:9/34 - (26%)
Similarity:14/34 - (41%) Gaps:0/34 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 VKAIDLFDTKVQKALETIDEDTFKPESFFSSRDS 157
            |.|.|....::...|..:.||...|..|..|:.:
plant    55 VMAADAEPLEILLHLPLLAEDKNVPYVFVPSKQA 88

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11808NP_611021.1 None
AT4G22380NP_193969.1 SNU13 7..128 CDD:411046 9/34 (26%)

Return to query results.
Submit another query.