DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11808 and AT2G47610

DIOPT Version :10

Sequence 1:NP_611021.1 Gene:CG11808 / 36687 FlyBaseID:FBgn0034000 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_182283.1 Gene:AT2G47610 / 819374 AraportID:AT2G47610 Length:257 Species:Arabidopsis thaliana


Alignment Length:53 Identity:15/53 - (28%)
Similarity:23/53 - (43%) Gaps:10/53 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   173 VTVASKPATAVRNEDVIF--HPNFLG-------DPDM-KAEKWLRKLYNYRQK 215
            |.||:|..||.:..:.:|  .|...|       ..|: :..||.:.:...|||
plant     7 VKVAAKKKTAEKVSNPLFERRPKQFGIGGALPPKKDLSRYIKWPKSIRLQRQK 59

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11808NP_611021.1 None
AT2G47610NP_182283.1 SNU13 18..256 CDD:455736 9/42 (21%)

Return to query results.
Submit another query.