DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11808 and Rsrc1

DIOPT Version :9

Sequence 1:NP_611021.1 Gene:CG11808 / 36687 FlyBaseID:FBgn0034000 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001343202.1 Gene:Rsrc1 / 66880 MGIID:1914130 Length:338 Species:Mus musculus


Alignment Length:289 Identity:84/289 - (29%)
Similarity:116/289 - (40%) Gaps:83/289 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 RRDRDRDRERDRDRD-RERDRERDRDRRHRSKSP-------SRS-SRQVSKPKKKKAKKSKKYSR 61
            ||.|...|...|||. |....||.|.||..|.|.       ||| ||...||.:.:..:||..:|
Mouse    46 RRPRSDSRSWSRDRQLRSHSYERRRRRRSSSSSSYGSRRKRSRSRSRGRGKPYRVQRSRSKSRTR 110

  Fly    62 RSRSSSRSTSRSSSSSRSSSRSTHSKSRTRDHHKSRSISQR---KTRG----------------- 106
            ||||..|..|.|.||.|||.|.|.|:||.||..|.|...:|   |.:|                 
Mouse   111 RSRSRPRPRSHSRSSERSSHRRTRSRSRDRDRRKVRDKEKREKEKDKGKDKEVHSIKRGDSGNIK 175

  Fly   107 -------PSSESNSR-----SATTPAAAPVKAIDLFDTKVQ-----------------KALETID 142
                   |:.::.:|     .|...|...:||.:..:.:.:                 |.:|.|:
Mouse   176 AGLEHLPPAEQAKARLQLVLEAAAKADEALKAKERSEEEAKRRKEEDQATLVEQVKRVKEIEAIE 240

  Fly   143 EDTFKPESFFSSRDSKETSDKVIIDLNNETVTVASKPA-------------------TAVRNED- 187
            .|:|..::|.||:|.|    |.:.....:.||.||.||                   ||::.:| 
Mouse   241 SDSFVQQTFRSSKDVK----KAVEPSEVQHVTAASGPASAAAEPPSTGKEIDPDSIPTAIKYQDD 301

  Fly   188 -VIFHPNFLGDPDMKAEKWLRKLYNYRQK 215
             .:.|||...:.....|||.::|...||:
Mouse   302 NSLAHPNLFIEKAEAEEKWFKRLIALRQE 330



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1358
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008308
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.900

Return to query results.
Submit another query.