DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11808 and NHP2

DIOPT Version :10

Sequence 1:NP_611021.1 Gene:CG11808 / 36687 FlyBaseID:FBgn0034000 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001383039.1 Gene:NHP2 / 55651 HGNCID:14377 Length:168 Species:Homo sapiens


Alignment Length:68 Identity:14/68 - (20%)
Similarity:26/68 - (38%) Gaps:18/68 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 SKSRTRDHHK--SRSISQRKTRGPSSESNSRSATTPAAAPVKAIDLFDTKVQKALETIDEDTFKP 148
            |:..||..:|  .:::.|::.|                ..||.:..|..|.:|.:..:..||...
Human    40 SRRLTRKLYKCIKKAVKQKQIR----------------RGVKEVQKFVNKGEKGIMVLAGDTLPI 88

  Fly   149 ESF 151
            |.:
Human    89 EVY 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11808NP_611021.1 None
NHP2NP_001383039.1 SNU13 32..>112 CDD:455736 14/68 (21%)

Return to query results.
Submit another query.