DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11808 and rsrc1

DIOPT Version :9

Sequence 1:NP_611021.1 Gene:CG11808 / 36687 FlyBaseID:FBgn0034000 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001016318.1 Gene:rsrc1 / 549072 XenbaseID:XB-GENE-5812529 Length:320 Species:Xenopus tropicalis


Alignment Length:306 Identity:83/306 - (27%)
Similarity:125/306 - (40%) Gaps:93/306 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DRDRRDRDRDRERDRDR--------------------DRERDRE-----RDRDRRHRSKSPS--R 40
            |.:..:|.|.:::.|.|                    .|.|.||     .|:.|||||.|.|  .
 Frog     7 DSEEENRSRKKKKHRKRSSSSSSSDGRTYSRKKSGKKSRSRSREGYSHSYDKRRRHRSSSESSYS 71

  Fly    41 SSRQVSKPKKKKAKKSKKY--SRRSRSSS--RSTSRSSSSSRSSSRSTHSKS--RTRDHHKSRSI 99
            |.|:.|..:.|...:::||  ||.|||.|  |..:||.||.|||.|.:.|||  |.|...|.:|.
 Frog    72 SRRKRSSSRSKDRGRTRKYHKSRTSRSKSRHRQRTRSRSSDRSSRRRSRSKSYDRERGKGKDKSK 136

  Fly   100 SQRKTRGPSSESNSRSAT----------TPAAAPVKA---------------------------- 126
            .:.|.||...||:|:.:.          .|.|...||                            
 Frog   137 MREKERGKVKESSSKPSDLVNIKAGLEHLPPAEQAKARLQMVLQAAAKADEALRAKERSEEEARK 201

  Fly   127 -------IDLFDTKVQKALETIDEDTFKPESFFSSRDSKETSDKV------------IIDLNNET 172
                   :.|...|..|.:|.|:.|:|.|::|.||||:|.:::.:            .|||.::|
 Frog   202 RKEEDQSVLLDHVKRAKEIELIESDSFVPQAFRSSRDTKASTESIETKHESAILGTGTIDLFDDT 266

  Fly   173 --VTVASKPAT-AVRNEDVIFHPNFLGDPDMKAEKWLRKLYNYRQK 215
              ..:...|.| ...:::.:.|||...:.:....||.::|.:.||:
 Frog   267 KESEIGIMPTTIKYLDDNCLAHPNLYIEKEEAELKWYKQLTSLRQE 312



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008308
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.