DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11808 and Nhp2

DIOPT Version :10

Sequence 1:NP_611021.1 Gene:CG11808 / 36687 FlyBaseID:FBgn0034000 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_080907.1 Gene:Nhp2 / 52530 MGIID:1098547 Length:153 Species:Mus musculus


Alignment Length:105 Identity:19/105 - (18%)
Similarity:37/105 - (35%) Gaps:18/105 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 KKKKAKKSKKYSRRSRSSSRSTSRSSSSSRSSSRSTHSKSRTRDHHK--SRSISQRKTRGPSSES 111
            |.|.|.:..:......|..|:......:....::...|:..||..:|  .:::.|::.|      
Mouse     3 KVKAAPEESEAQAEGCSEERTYKELLVNLNPIAQPLASRRLTRKLYKCIKKAVKQKQIR------ 61

  Fly   112 NSRSATTPAAAPVKAIDLFDTKVQKALETIDEDTFKPESF 151
                      ..||.:..|..|.:|.:..:..||...|.:
Mouse    62 ----------RGVKEVQKFVNKGEKGIMVLAGDTLPIEVY 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11808NP_611021.1 None
Nhp2NP_080907.1 SNU13 32..130 CDD:455736 14/76 (18%)

Return to query results.
Submit another query.