DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11808 and NHP2

DIOPT Version :10

Sequence 1:NP_611021.1 Gene:CG11808 / 36687 FlyBaseID:FBgn0034000 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_651965.1 Gene:NHP2 / 44005 FlyBaseID:FBgn0029148 Length:160 Species:Drosophila melanogaster


Alignment Length:52 Identity:16/52 - (30%)
Similarity:24/52 - (46%) Gaps:5/52 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 NETVTVASKPATAVRNE---DVIFHPNFLGDPDMKAEKWLRKLYNYRQKYMQ 218
            :|:| |||...|....|   |.:...|.:..| |..:|..:|.|...:|.|:
  Fly    13 DESV-VASGDVTIKEEESYDDKLIFVNAIAKP-MAGKKLAKKCYKLVKKAMK 62

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11808NP_611021.1 None
NHP2NP_651965.1 Ribosomal_L7Ae 51..146 CDD:426153 4/12 (33%)

Return to query results.
Submit another query.