DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11808 and rpp38

DIOPT Version :9

Sequence 1:NP_611021.1 Gene:CG11808 / 36687 FlyBaseID:FBgn0034000 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001002525.2 Gene:rpp38 / 436798 ZFINID:ZDB-GENE-040718-258 Length:265 Species:Danio rerio


Alignment Length:101 Identity:24/101 - (23%)
Similarity:36/101 - (35%) Gaps:25/101 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 VSKPKKKKAKKSKKYSRRSRSSSRSTSRSSSSSRSSSRSTH------------------SKSRTR 91
            :|.|.|...||.||.....::|..:......|.....:..|                  ..||.|
Zfish     1 MSTPAKGATKKEKKKPIPVKTSLNNPYNIGWSDLLQKQHKHLILDTLKEKLSATGLRKERVSRFR 65

  Fly    92 DHHKSRSISQRKTRGPSSESNSRSATTPAAAPVKAI 127
            | ..||..|::|...|:.|.|      ||:.|.:::
Zfish    66 D-WGSRRRSRKKASKPTEEQN------PASEPAESV 94

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11808NP_611021.1 None
rpp38NP_001002525.2 Ribosomal_L7Ae 104..178 CDD:279573
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1358
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.