DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11808 and rsrc1

DIOPT Version :9

Sequence 1:NP_611021.1 Gene:CG11808 / 36687 FlyBaseID:FBgn0034000 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_998112.2 Gene:rsrc1 / 405883 ZFINID:ZDB-GENE-040426-2374 Length:308 Species:Danio rerio


Alignment Length:285 Identity:83/285 - (29%)
Similarity:114/285 - (40%) Gaps:73/285 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RDRRDRDRD--------------RERDRDRDRERDRERDRDRRHRSKSPS---------RSSRQV 45
            |.||.|.|.              ..:.|.|.|.|||.|..|||||::|.|         |.||..
Zfish    16 RKRRQRQRSSSSSSESRVTSRSKHSKRRTRSRSRDRNRTTDRRHRNRSHSSSSRGSGHRRRSRSA 80

  Fly    46 SKPKKKKAKKSKKYSRRSRSSSR-STSRSSSSSRSS----------SRSTHSKSRTRDHHKSRSI 99
            .:.:..::.:|:..||..||.|| ..|||.||.|||          .|.|..|.||||..|.:..
Zfish    81 DRGRSHRSHRSRSRSRNRRSRSRHRRSRSCSSGRSSRKRSRERDRGQRRTRDKDRTRDRTKDKDT 145

  Fly   100 SQRKTRGPSSESNSRSA---------TTPAAAPV-----KAIDLFDTKVQ--------------- 135
            .:.|.:....|:.:..|         .|.|...|     |..|...||..               
Zfish   146 DKAKEKDKQRETGNIKAGSEHLTSAEQTKARLQVLQTAAKTDDAQKTKENVKVGGAIKEEEEVSL 210

  Fly   136 -------KALETIDEDTFKPESFFSSRDSKETSDKVIIDLNNET--VTVASKPATAVRNE-DVIF 190
                   |.:|.|:.|:|.|::|.||||:.:.::...|....||  |.|:..|.:...|: |.:.
Zfish   211 AEQVRRIKDIEAIESDSFVPQAFKSSRDASKVTECPEIKTEAETVKVEVSVLPTSITYNDSDTLA 275

  Fly   191 HPNFLGDPDMKAEKWLRKLYNYRQK 215
            |||...|.:.....||.:|.:.||:
Zfish   276 HPNLFVDKEEAERLWLNRLISLRQE 300



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 85 1.000 Domainoid score I8107
eggNOG 1 0.900 - - E1_COG1358
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 86 1.000 Inparanoid score I5147
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008308
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.