DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11808 and RpL7A

DIOPT Version :9

Sequence 1:NP_611021.1 Gene:CG11808 / 36687 FlyBaseID:FBgn0034000 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001284944.1 Gene:RpL7A / 31588 FlyBaseID:FBgn0014026 Length:271 Species:Drosophila melanogaster


Alignment Length:184 Identity:36/184 - (19%)
Similarity:58/184 - (31%) Gaps:59/184 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 VSKPKKKKAKKSKKYSR------------------RSRSSSRSTSRSSSSSRSSSRSTHSKSRTR 91
            |.||:.||...:||.:.                  ..|..:....::....|..||........|
  Fly     3 VKKPRPKKKPVTKKVAPAPLAVKKPVVKKVVNQLFEKRPKNFGIGQNVQPKRDLSRFVRWPKYIR 67

  Fly    92 DHHKSRSISQRKTRGP---SSESNSRSATTPAAAPVKAIDLFDTKVQKALETIDEDTFKPESFFS 153
             ..:.:::.|::.:.|   ...|.:...||       |:.||     |.||     .::|||..:
  Fly    68 -VQRQKAVLQKRLKVPPPIHQFSQTLDKTT-------AVKLF-----KLLE-----KYRPESPLA 114

  Fly   154 SR----------------DSKETSDKVIIDLNNETVTVASKPATAVRNEDVIFH 191
            .:                :.|:....|....|..|..:..|.|..|    ||.|
  Fly   115 KKLRLKKIAEAKAKGKDVEPKKKPSYVSAGTNTVTKLIEQKKAQLV----VIAH 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11808NP_611021.1 None
RpL7ANP_001284944.1 PTZ00365 18..271 CDD:240382 29/169 (17%)
Ribosomal_L7Ae 37..257 CDD:294400 29/150 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1358
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.