powered by:
Protein Alignment CG11808 and Rpl7a
DIOPT Version :9
Sequence 1: | NP_611021.1 |
Gene: | CG11808 / 36687 |
FlyBaseID: | FBgn0034000 |
Length: | 219 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001107863.1 |
Gene: | Rpl7a / 296596 |
RGDID: | 1307586 |
Length: | 266 |
Species: | Rattus norvegicus |
Alignment Length: | 39 |
Identity: | 13/39 - (33%) |
Similarity: | 20/39 - (51%) |
Gaps: | 3/39 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 19 RDRERDRERDRDRRHRSKS--PSRSSRQVSKPKKKKAKK 55
|....|| .|..|||...: ..:|..:::|.:|.|||:
Rat 223 RTNYNDR-YDEIRRHWGGNVLGPKSVARIAKLEKAKAKE 260
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG11808 | NP_611021.1 |
None |
Rpl7a | NP_001107863.1 |
PTZ00365 |
16..266 |
CDD:240382 |
13/39 (33%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG1358 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.