DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11808 and Rpl7a

DIOPT Version :9

Sequence 1:NP_611021.1 Gene:CG11808 / 36687 FlyBaseID:FBgn0034000 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001107863.1 Gene:Rpl7a / 296596 RGDID:1307586 Length:266 Species:Rattus norvegicus


Alignment Length:39 Identity:13/39 - (33%)
Similarity:20/39 - (51%) Gaps:3/39 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 RDRERDRERDRDRRHRSKS--PSRSSRQVSKPKKKKAKK 55
            |....|| .|..|||...:  ..:|..:::|.:|.|||:
  Rat   223 RTNYNDR-YDEIRRHWGGNVLGPKSVARIAKLEKAKAKE 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11808NP_611021.1 None
Rpl7aNP_001107863.1 PTZ00365 16..266 CDD:240382 13/39 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1358
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.