DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11808 and rps-12

DIOPT Version :10

Sequence 1:NP_611021.1 Gene:CG11808 / 36687 FlyBaseID:FBgn0034000 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_498221.1 Gene:rps-12 / 175786 WormBaseID:WBGene00004481 Length:140 Species:Caenorhabditis elegans


Alignment Length:53 Identity:11/53 - (20%)
Similarity:17/53 - (32%) Gaps:11/53 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 RGPSSESNSRSATTPAA-----------APVKAIDLFDTKVQKALETIDEDTF 146
            :||..:..:..|...||           ...||:|..:.......|..||..:
 Worm    17 QGPMDKEGALRAVLRAAHHADGLAKGLHETCKALDKREAHFCVLAENCDEPQY 69

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11808NP_611021.1 None
rps-12NP_498221.1 Ribosomal_L7Ae 25..119 CDD:426153 9/45 (20%)

Return to query results.
Submit another query.