DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8093 and Lip1

DIOPT Version :9

Sequence 1:NP_001286441.1 Gene:CG8093 / 36686 FlyBaseID:FBgn0033999 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_001285811.1 Gene:Lip1 / 43973 FlyBaseID:FBgn0023496 Length:439 Species:Drosophila melanogaster


Alignment Length:371 Identity:137/371 - (36%)
Similarity:210/371 - (56%) Gaps:28/371 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 SSVTTVTIVRGHGYEIEEHEVQTSDGYILTMHRIPYSKNTGYDGPRPVVFLMHGLLCSSSDWVLA 91
            |:::...::..:|||.|.|.|.|.||||||||||   :..|    .|...|.|||:.||:.:|:.
  Fly    64 STLSVDKLIAKYGYESEVHHVTTEDGYILTMHRI---RKQG----APPFLLQHGLVDSSAGFVVM 121

  Fly    92 GPHSGLAYLLSEAGYDVWMGNARGNTYSKRHASKSPLLQPFWNFEWHDIGIYDLPAMMDYVLYWT 156
            ||:..|||||::..||||:||||||.||:.|.:..|....||:|.||:||:||||||:|:||..|
  Fly   122 GPNVSLAYLLADHNYDVWLGNARGNRYSRNHTTLDPDESKFWDFSWHEIGMYDLPAMIDHVLKVT 186

  Fly   157 NVTQLTYVGHSQGTTSFFVLNSMIPRFKSRIRSAHLLAPVAWMEHMES-----PLATVGGPLLGQ 216
            ...:|.|.|||||.|||||:.||.|.:..::.|...|||..:.:..|.     .::.....|:| 
  Fly   187 GFPKLHYAGHSQGCTSFFVMCSMRPAYNDKVVSMQALAPAVYAKETEDHPYIRAISLYFNSLVG- 250

  Fly   217 PNAFVELFGSAEFLPNTQLMNLFGALLCSDEAISQFMCTNTLFLLGGWNSPYINETLLPDIMATT 281
             ::..|:| :.||           ..||.....::.:|...:|.:.|.|....|..:.|.|:...
  Fly   251 -SSIREMF-NGEF-----------RFLCRMTEETERLCIEAVFGIVGRNWNEFNRKMFPVILGHY 302

  Fly   282 PAGCSVNQIFHYLQEYNSGYFRQFDYGSTRNKKEYSSKTPPEYDVEGIDVPTYLYYSDNDYFASL 346
            |||.:..|:.|::|...||.|..:.|.|.:|.:.|....||.|::..:.|||::|||.||.....
  Fly   303 PAGVAAKQVKHFIQIIKSGRFAPYSYSSNKNMQLYRDHLPPRYNLSLVTVPTFVYYSTNDLLCHP 367

  Fly   347 IDVDRLRYTMNPSALKSAYRMPEEKWNHIDFLWGLNIKEILYDRVI 392
            .||:.:...:  ..:...|.:|::::||:||||.::::::||.|::
  Fly   368 KDVESMCDDL--GNVTGKYLVPQKEFNHMDFLWAIDVRKMLYRRML 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8093NP_001286441.1 PLN02872 9..392 CDD:215470 137/369 (37%)
Abhydro_lipase 31..92 CDD:282003 26/60 (43%)
Abhydrolase_5 74..>214 CDD:289465 65/144 (45%)
Lip1NP_001285811.1 Abhydro_lipase 71..122 CDD:282003 26/57 (46%)
Abhydrolase_1 103..399 CDD:278959 114/311 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439487
Domainoid 1 1.000 150 1.000 Domainoid score I1414
eggNOG 1 0.900 - - E2759_KOG2624
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 194 1.000 Inparanoid score I1354
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D39202at50557
OrthoFinder 1 1.000 - - FOG0000083
OrthoInspector 1 1.000 - - otm26515
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11005
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X80
109.900

Return to query results.
Submit another query.