DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8093 and CG11598

DIOPT Version :9

Sequence 1:NP_001286441.1 Gene:CG8093 / 36686 FlyBaseID:FBgn0033999 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_001036710.1 Gene:CG11598 / 41554 FlyBaseID:FBgn0038067 Length:388 Species:Drosophila melanogaster


Alignment Length:377 Identity:130/377 - (34%)
Similarity:198/377 - (52%) Gaps:29/377 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 ASSVTTVTIVRGHGYEIEEHEVQTSDGYILTMHRIPYSKNTGYDGPRPVVFLMHGLLCSSSDWVL 90
            |..:.|..|:..|.|.:|.|.|.|.|||:|...|||.||.....||:|.|...||:..||..::|
  Fly    16 AKGLITSEIIASHNYPVEVHTVLTRDGYLLDAFRIPGSKFCQQSGPKPAVLFQHGMSASSDVFLL 80

  Fly    91 AGPHSGLAYLLSEAGYDVWMGNARGNTYSKRHASKSPLLQPFWNFEWHDIGIYDLPAMMDYVLYW 155
            .||...||::|::|.:|||:.|:||..||:||.|..|..:.||.|.||:||..|:.|.:||:|..
  Fly    81 NGPQDSLAFMLADACFDVWLSNSRGTRYSRRHVSLDPSDEAFWRFSWHEIGTEDVAAFIDYILDT 145

  Fly   156 TNVTQLTYVGHSQGTTSFFVLNSMIPRFKSRIRSAHLLAPVAWMEHMESPLATVGGPLLGQPNAF 220
            |....|.::|||||.|:..||.||.|.:...:::|.||||..:|.|..:...||.       .:|
  Fly   146 TKQRALHFLGHSQGCTTLVVLLSMRPEYNKLVKTAVLLAPAVFMRHTSTLSQTVF-------RSF 203

  Fly   221 VELFGSAEFLPNTQLMNLFGALLCSDEAISQFMCTNTLFLLGGWNSPYINETLLPDIMATTPAGC 285
            :......||:.:..::|...:.:|. ..:::..||....:..|..|.::|.:::|.|.||.|||.
  Fly   204 IMAMPDKEFMYHNGVLNKLLSNVCG-LFVARVFCTTFFLISNGKISKHLNTSVIPLIAATLPAGV 267

  Fly   286 SVNQIFHYLQEYNSGYFRQFDYGSTRNKKEYSSKTPPEYDVEGID--VPTYLYYSDNDYFASLID 348
            |..|..|::|..:||.||.||:|..||...|.|..||:|.:..:.  .|.:::|||:|...:..|
  Fly   268 SSRQPKHFIQLTDSGKFRPFDFGILRNLINYKSLEPPDYTLSNVRPLTPVHIFYSDDDSSTAKED 332

  Fly   349 VDRLRYTMNPSALKSAYRMPE--------EKWNHIDFLWGLNIKEILYDRVI 392
            :...           |.|:||        ..|:|.||:..:.:.:::...||
  Fly   333 IQNF-----------AARVPEVVMHRISTPGWHHTDFVHSMTVADVINKPVI 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8093NP_001286441.1 PLN02872 9..392 CDD:215470 128/375 (34%)
Abhydro_lipase 31..92 CDD:282003 26/60 (43%)
Abhydrolase_5 74..>214 CDD:289465 58/139 (42%)
CG11598NP_001036710.1 Abhydro_lipase 21..82 CDD:282003 26/60 (43%)
PLN02872 22..384 CDD:215470 128/371 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471683
Domainoid 1 1.000 150 1.000 Domainoid score I1414
eggNOG 1 0.900 - - E2759_KOG2624
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I1188
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D40422at6656
OrthoFinder 1 1.000 - - FOG0000083
OrthoInspector 1 1.000 - - mtm1092
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11005
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X80
109.900

Return to query results.
Submit another query.