DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment row and ZFY

DIOPT Version :9

Sequence 1:NP_001260992.1 Gene:row / 36685 FlyBaseID:FBgn0033998 Length:1301 Species:Drosophila melanogaster
Sequence 2:NP_001356631.1 Gene:ZFY / 7544 HGNCID:12870 Length:801 Species:Homo sapiens


Alignment Length:652 Identity:138/652 - (21%)
Similarity:217/652 - (33%) Gaps:175/652 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   388 LGGPGKFVEVGVISLGTTSQDGSQRQ-VKV-----EVLGVY--------DYAEKSIRLRAVEPIT 438
            |...||....|  |.|.|....|:.. .||     ||:.||        |....::.:...||..
Human   212 LDDAGKIEHDG--STGVTIDAESEMDPCKVDSTCPEVIKVYIFKADPGEDDLGGTVDIVESEPEN 274

  Fly   439 DGDRNYKKRFQAILEPLSRWVH--------KDSTICIDLTVDKITL-FSMGFKNIVQAAATDNTA 494
            |.......:..:|..|..:.|:        :|..:.:....|::.: ..:|.::...|||.  .|
Human   275 DHGVELLDQNSSIRVPREKMVYMTVNDSQQEDEDLNVAEIADEVYMEVIVGEEDAAVAAAA--AA 337

  Fly   495 KHNNSAVMEYLRRIVPRMFQNTLSLLSRQMIQQFLDELVWRESFGTYALQAFN-----NIIIHIA 554
            .|......:.::..||                     :.|..::|..:....|     :.::||.
Human   338 VHEQQIDEDEMKTFVP---------------------IAWAAAYGNNSDGIENRNGTASALLHID 381

  Fly   555 E--------QTRVTTNETITQRLYQVAT------------------NPFKDWSILPANYKETPAN 593
            |        :.:.........|.||.|.                  ..||....|..:.|..|.:
Human   382 ESAGLGRLAKQKPKKKRRPDSRQYQTAIIIGPDGHPLTVYPCMICGKKFKSRGFLKRHMKNHPEH 446

  Fly   594 AAPKRLKKPINDADYVVSNKI------------PKKEKDRDIASSGVKRGRPPNALGTPPPQLPI 646
            .|.|  |....|.||..:.||            .|.||..:....| |......||.| ...:..
Human   447 LAKK--KYHCTDCDYTTNKKISLHNHLESHKLTSKAEKAIECDECG-KHFSHAGALFT-HKMVHK 507

  Fly   647 KKGPGRPPGSTNQTKGDRATTSSSKSLSKSLIAKGLGKKPKEKDEKIPMVIKKEEDDLRGLEEL- 710
            :||..:    .::.|.....|:....|::.|:|        ...:..|.:..:.....|...|| 
Human   508 EKGANK----MHKCKFCEYETAEQGLLNRHLLA--------VHSKNFPHICVECGKGFRHPSELR 560

  Fly   711 -YYGISDGTDEYHEIFPYSTPRTVHNELAKT-----------VECPICLNGDSFDSNEKLQTHLV 763
             :..|..|...|.  ..|...|:..:...||           .:|.|||.  :|...:::|.|.:
Human   561 KHMRIHTGEKPYQ--CQYCEYRSADSSNLKTHIKTKHSKEMPFKCDICLL--TFSDTKEVQQHTL 621

  Fly   764 SHISPEGKQHQFQCLFCLEKHPTESVLAKHNQIMH-----------------PTETKT-----EG 806
            .|  .|.|.|  |||.|..|....|.|.:|...:|                 |:|.|.     :|
Human   622 VH--QESKTH--QCLHCDHKSSNSSDLKRHVISVHTKDYPHKCEMCEKGFHRPSELKKHVAVHKG 682

  Fly   807 SPSYYCLICQQRHNSLHLLTAHLQKVHSTLELPYWCHSC--GYRSSSHRDLVRHFYDDHKHQNFL 869
            ...:.|..|..:.....:|:.|:..|| |.:||:.|..|  |:|..:  :|.:|. ..|..:...
Human   683 KKMHQCRHCDFKIADPFVLSRHILSVH-TKDLPFRCKRCRKGFRQQN--ELKKHM-KTHSGRKVY 743

  Fly   870 QCPYC----LDIFYFSKLGVVNQLRIEHYFMHLDEHINKRDPSLRCQKCSLSFLEKGDLKQHAVQ 930
            ||.||    .|...| |..|::              |:.:|...||:.|...|....:..||.::
Human   744 QCEYCEYSTTDASGF-KRHVIS--------------IHTKDYPHRCEYCKKGFRRPSEKNQHIMR 793

  Fly   931 HH 932
            ||
Human   794 HH 795

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rowNP_001260992.1 C2H2 Zn finger 777..798 CDD:275368 7/20 (35%)
C2H2 Zn finger 812..833 CDD:275368 4/20 (20%)
C2H2 Zn finger 842..858 CDD:275368 5/17 (29%)
ZFYNP_001356631.1 Zfx_Zfy_act 71..406 CDD:309717 38/218 (17%)
COG5048 <417..592 CDD:227381 39/192 (20%)
C2H2 Zn finger 423..443 CDD:275368 4/19 (21%)
C2H2 Zn finger 454..478 CDD:275368 5/23 (22%)
C2H2 Zn finger 486..506 CDD:275368 5/21 (24%)
COG5048 539..>676 CDD:227381 34/144 (24%)
C2H2 Zn finger 546..566 CDD:275368 3/19 (16%)
zf-H2C2_2 558..582 CDD:338759 7/25 (28%)
C2H2 Zn finger 574..593 CDD:275368 4/18 (22%)
C2H2 Zn finger 603..652 CDD:275368 19/54 (35%)
C2H2 Zn finger 660..680 CDD:275368 3/19 (16%)
zf-C2H2 715..737 CDD:333835 6/24 (25%)
C2H2 Zn finger 717..737 CDD:275368 6/22 (27%)
zf-H2C2_2 729..753 CDD:338759 7/24 (29%)
C2H2 Zn finger 745..766 CDD:275368 7/35 (20%)
C2H2 Zn finger 774..794 CDD:275368 5/19 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24408
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.