DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment row and Zfp787

DIOPT Version :9

Sequence 1:NP_001260992.1 Gene:row / 36685 FlyBaseID:FBgn0033998 Length:1301 Species:Drosophila melanogaster
Sequence 2:NP_001013030.1 Gene:Zfp787 / 67109 MGIID:1914359 Length:381 Species:Mus musculus


Alignment Length:402 Identity:84/402 - (20%)
Similarity:122/402 - (30%) Gaps:135/402 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   743 CPICLNGDSFDSNEKLQTHLVSHISPEGKQHQFQCLFCLEKHPTESVLAKHNQIMHPTETKTEGS 807
            |..|  |.||....||..|..:|..    :....|..|.:.....|.|.:|.:| |      .|.
Mouse    68 CTEC--GKSFSHWSKLTRHQRTHTG----ERPNACTDCGKTFSQSSHLVQHRRI-H------TGE 119

  Fly   808 PSYYCLICQQRHNSLHLLTAHLQKVHSTLELPYWCHSCGYRSSSHRDLVRHFYDDHKHQNFLQCP 872
            ..|.|..|.:|.:....|..| |::| |.|.||.|..||...:..:.|.:| ...|.......||
Mouse   120 KPYACSECGKRFSWSSNLMQH-QRIH-TGEKPYTCPDCGRSFTQSKSLAKH-RRSHSGLKPFVCP 181

  Fly   873 YCLDIFYFSKLGVVNQLRIEHYFMHLDEHINKRDPSLRCQKCSLSFLEKGDLKQHAVQHHVSMTK 937
            .|...|...| .:...||:         |.....|.:..:..:.| :.:....:.|       |.
Mouse   182 RCGRGFSQPK-SLARHLRL---------HPELSGPGVAAKVLAAS-VRRAKAPEEA-------TA 228

  Fly   938 TNRPVRLLLNNS---MLIPPP----------------KIRTHHREQPPFSTYKRPVFFAFLEGKT 983
            .:..:.:.:.:.   :::.||                ...|..|..|....|            .
Mouse   229 ADGEIAIPVGDGEGIIVVGPPGDGAAAAAALAGVGTRATGTRSRRAPAPKPY------------V 281

  Fly   984 CAECNTDFASEETHYTGWL-HCVKCNYQTCCERAQFRHG---------------VECNGNFVDAM 1032
            |.||...|.    |..|.| |          :|||  ||               |||...||...
Mouse   282 CMECGKGFG----HGAGLLAH----------QRAQ--HGDGLGVAVGEEPAHICVECGEGFVQGA 330

  Fly  1033 EVNMPQEMHC-----ICGFATGNGNKMAQHLANCGLSTCYPSLEAASENAVKRNMLDMLGLVRRD 1092
            .:...:::|.     :|              ::||.|    ...|..|:               |
Mouse   331 ALRRHKKIHAVGAPSVC--------------SSCGQS----FYRAGGED---------------D 362

  Fly  1093 GETSGEGADISE 1104
            ||....||..:|
Mouse   363 GEDQSAGARCAE 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rowNP_001260992.1 C2H2 Zn finger 777..798 CDD:275368 6/20 (30%)
C2H2 Zn finger 812..833 CDD:275368 6/20 (30%)
C2H2 Zn finger 842..858 CDD:275368 4/15 (27%)
Zfp787NP_001013030.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..65
zf-C2H2 66..88 CDD:395048 8/21 (38%)
C2H2 Zn finger 68..88 CDD:275368 8/21 (38%)
COG5048 <93..200 CDD:227381 33/126 (26%)
C2H2 Zn finger 96..116 CDD:275368 6/20 (30%)
C2H2 Zn finger 124..144 CDD:275368 6/20 (30%)
C2H2 Zn finger 152..172 CDD:275368 5/20 (25%)
C2H2 Zn finger 180..200 CDD:275368 7/29 (24%)
C2H2 Zn finger 282..302 CDD:275368 9/33 (27%)
C2H2 Zn finger 319..339 CDD:275368 5/19 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24408
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.