DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment row and Plagl2

DIOPT Version :9

Sequence 1:NP_001260992.1 Gene:row / 36685 FlyBaseID:FBgn0033998 Length:1301 Species:Drosophila melanogaster
Sequence 2:NP_061277.2 Gene:Plagl2 / 54711 MGIID:1933165 Length:496 Species:Mus musculus


Alignment Length:547 Identity:108/547 - (19%)
Similarity:175/547 - (31%) Gaps:143/547 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   714 ISDGTDEYHEIFPYSTPRTVHNELAKTVECPICLNGDSFDSNEKLQTHLVSHISPEGKQHQFQCL 778
            |.|...| .|:.....||....|....|:|...::|..|.:.|||:.|.:.|  ||.:.:.    
Mouse    12 IQDAKQE-EEVGWKLVPRPRGREAESQVKCQCEISGTPFSNGEKLRPHSLPH--PEQRPYS---- 69

  Fly   779 FCLEKHPTESVLAKHNQIMHPTETKTEGSPSYYCLICQQRHNSLHLLTAHLQKVHSTLELPYWCH 843
             |.:.|..::..:|:....| ..|.:...| :.|:.|.:..:....|..||| .|...:....|.
Mouse    70 -CPQLHCGKAFASKYKLYRH-MATHSAQKP-HQCMYCDKMFHRKDHLRNHLQ-THDPNKEALHCS 130

  Fly   844 SCGYRSSSHRDLVRHFYDDHKHQNFLQCPYCLDIFYFSKLGVVNQLRIEHYFMHLDEHI-----N 903
            .||...::.....||..........|.|..||..|..:      |..:||...| ...:     .
Mouse   131 ECGKNYNTKLGYRRHLAMHAASSGDLSCKVCLQTFEST------QALLEHLKAH-SRRVAGGAKE 188

  Fly   904 KRDPSLRCQKCSLSFLEKGDLKQHAVQHHVSMTKTNRPVRLLLNNSMLIPPPKIRTHHREQPPFS 968
            |:.|   |..|...|..:.|:::|.|.|      |.|.                           
Mouse   189 KKHP---CDHCDRRFYTRKDVRRHLVVH------TGRK--------------------------- 217

  Fly   969 TYKRPVFFAFLEGKTCAECNTDFASEETHYTGWLHCVKCNYQTCCERAQFRHGVECNGNFVDAME 1033
                    .||    |..|...|..:: |.|  .|..|.:.|                   :.::
Mouse   218 --------DFL----CQYCAQRFGRKD-HLT--RHVKKSHSQ-------------------ELLK 248

  Fly  1034 VNM-PQEMHCICGFATGNGNKMAQHLANCGLSTCYPSLEAASENAVKRNMLDMLGLVRRD--GET 1095
            :.. |.:|                    .||.:|      :|..:||..:..:|.:..||  |..
Mouse   249 IKTEPVDM--------------------LGLLSC------SSTVSVKEELSPVLCMASRDVMGAK 287

  Fly  1096 SGEG-ADISETADDVADQSSDMLPPQEDHHLQQHHQQVGHQQQMQGQPNEPQAELQQEYLSAPVE 1159
            :..| ..:......:....|..:|    |.|..:...:|....::..|....|:|..:|......
Mouse   288 AFPGMLPMGMYGAHIPTMPSAGMP----HSLVHNTLPMGMSYPLESSPISSSAQLPPKYQLGSTS 348

  Fly  1160 HEPVQNMPVH-QSMPVQQTGPIQFGEMEAAPVLLDTQQQVQPTPDYAQVSVVQQHQQQQPYGLSN 1223
            :.|.:...|. .|...:..|.:.....|..|        ..|.|..|...:.:....:.|   :|
Mouse   349 YLPDKLPKVEVDSFLAELPGSLSLSSAEPQP--------ASPQPAAAAALLDEALLAKSP---AN 402

  Fly  1224 YGQSSLATDIDMP-LIGELSEP-NAPP 1248
            ..::..|.::|.. |:|.|  | |.||
Mouse   403 LSEALCAANVDFSHLLGFL--PLNLPP 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rowNP_001260992.1 C2H2 Zn finger 777..798 CDD:275368 3/20 (15%)
C2H2 Zn finger 812..833 CDD:275368 6/20 (30%)
C2H2 Zn finger 842..858 CDD:275368 3/15 (20%)
Plagl2NP_061277.2 C2H2 Zn finger 42..62 CDD:275368 6/19 (32%)
C2H2 Zn finger 70..92 CDD:275368 4/22 (18%)
zf-H2C2_2 85..109 CDD:372612 5/25 (20%)
C2H2 Zn finger 100..120 CDD:275368 6/20 (30%)
C2H2 Zn finger 129..149 CDD:275368 5/19 (26%)
C2H2 Zn finger 158..178 CDD:275368 7/25 (28%)
C2H2 Zn finger 193..213 CDD:275368 6/19 (32%)
C2H2 Zn finger 221..239 CDD:275368 6/20 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24408
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.