DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment row and Zfp316

DIOPT Version :9

Sequence 1:NP_001260992.1 Gene:row / 36685 FlyBaseID:FBgn0033998 Length:1301 Species:Drosophila melanogaster
Sequence 2:NP_059495.3 Gene:Zfp316 / 54201 MGIID:1860402 Length:1017 Species:Mus musculus


Alignment Length:650 Identity:130/650 - (20%)
Similarity:194/650 - (29%) Gaps:216/650 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   687 KEKDEKIPMVIKKEEDDLRGLEELYYGISDGTDEYHEIFPYSTPRTVHNELAKTVECPICLNGDS 751
            :|.||.....:.:||::..||....||:.|            .|.|...:.:.:|:.|     :.
Mouse   246 EEDDEDFLAEVAEEENEPPGLWSAAYGVGD------------VPGTWGPDDSDSVQTP-----EG 293

  Fly   752 FDSNEKLQTHLVSHISPEGKQHQFQCLFCLEKHPTESVLAKHNQIMHPTETKTEGSPSYYCLICQ 816
            :..|......|...:  |.|.      |...:.|.|:.|...   ..|......|.|...|.:|.
Mouse   294 WGPNPGSLGILAEEV--EAKH------FLSGREPGENFLVPW---AFPAVAVPIGCPETTCDVCG 347

  Fly   817 QRHNSLHLLTAHLQKVHSTLELPYWCHSCG----YRSSSHRDLVRHFYDDHKHQNFLQCPYCLDI 877
            :.......|..| |:.|:.:: |:.|..||    |||    .|..| ...|..:....||.|...
Mouse   348 KVFPHRSRLAKH-QRYHAAVK-PFGCDECGKGFVYRS----HLAIH-QRTHTGEKPFPCPDCGKR 405

  Fly   878 FYFSKLGVVNQLRIEHYFMHLDEHINKRDPSLRCQKCSLSFLEKGDLKQHAVQHHVSMTKTNRPV 942
            |.:.          .|...|...|..:|  ..||..|...|..:..|..|.              
Mouse   406 FVYK----------SHLVTHRRIHTGER--PYRCVFCGAGFGRRSYLVTHQ-------------- 444

  Fly   943 RLLLNNSMLIPPPKIRTHHREQPPFSTYKRPVFFAFLEGKTCAECNTDFAS-------EETHYTG 1000
                           |||..|:|                ..|..|...|:.       :..|...
Mouse   445 ---------------RTHTGERP----------------YPCLHCGRSFSQSSALARHQAVHTAD 478

  Fly  1001 WLHCVKCNYQTCCERAQF-RHGVECNGNFVDAMEVNMPQEMHCICGFATGNGNKMAQH------- 1057
            ..||.....|....||.| ||  ..:|...:.               ::|:|.:||.|       
Mouse   479 RPHCCPDCGQAFRLRADFQRH--RRSGGCTEP---------------SSGDGARMAPHEVGMAPN 526

  Fly  1058 ---LANCGLSTCYP-SLEAASENAVKRNMLDMLGLVRRDGETSGEGAD-----ISETAD-DVADQ 1112
               :|...::|..| .||||.....:..    .|:.  ||:|..|...     ::..|: .|.|.
Mouse   527 EVEMAVAAVATVEPEELEAAPAETEEPE----AGVA--DGDTEAEARQDEQVVVAPAAEATVPDS 585

  Fly  1113 SSDMLPPQEDHHLQQHHQQVGHQQQMQGQPNEPQAELQQEYLSAPVEHEPVQNMPVHQSMPVQQT 1177
            ..|   |:.|...::....:.     :|:              .|..|....:.|:|        
Mouse   586 KKD---PEPDRRFREMGNGLA-----EGE--------------GPSSHPFGFHFPMH-------- 620

  Fly  1178 GPIQFGEMEAAPVLLDTQQQVQPTPDYAQVSVVQQHQQQQPYG--LSNYGQSSLATD-------- 1232
             |..:...:..|:|        ..|::::...........|.|  ||..|. .||.|        
Mouse   621 -PKSWLHPDGFPIL--------GFPEFSERLQADGRHLPGPLGSPLSLQGM-GLACDPFRSVGPG 675

  Fly  1233 --ID------MPLIGE-LSEPNAPPTPQFLGEVHTPMFDA---------VAAAEQQHYHAQHHHH 1279
              :|      .|.:.. |||    |.|..|.|..:|...:         .|.|:.|.|||....|
Mouse   676 AGVDGGLRAFPPAVRSLLSE----PAPAALAEEESPWICSDCGKTFGRRAALAKHQRYHAGERPH 736

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rowNP_001260992.1 C2H2 Zn finger 777..798 CDD:275368 4/20 (20%)
C2H2 Zn finger 812..833 CDD:275368 5/20 (25%)
C2H2 Zn finger 842..858 CDD:275368 7/19 (37%)
Zfp316NP_059495.3 KRAB 155..215 CDD:214630
COG5048 <339..499 CDD:227381 46/223 (21%)
C2H2 Zn finger 343..363 CDD:275368 5/20 (25%)
C2H2 Zn finger 371..391 CDD:275368 8/24 (33%)
zf-H2C2_2 383..408 CDD:372612 7/25 (28%)
C2H2 Zn finger 399..419 CDD:275368 6/29 (21%)
C2H2 Zn finger 427..447 CDD:275368 6/48 (13%)
C2H2 Zn finger 455..475 CDD:275368 3/19 (16%)
C2H2 Zn finger 483..501 CDD:275368 6/19 (32%)
PRK13108 <507..584 CDD:237284 19/97 (20%)
C2H2 Zn finger 710..730 CDD:275368 3/19 (16%)
zf-C2H2 710..730 CDD:333835 3/19 (16%)
zf-H2C2_2 722..747 CDD:372612 6/14 (43%)
C2H2 Zn finger 738..758 CDD:275368
COG5048 <763..950 CDD:227381
C2H2 Zn finger 766..786 CDD:275368
C2H2 Zn finger 794..814 CDD:275368
C2H2 Zn finger 822..842 CDD:275368
C2H2 Zn finger 850..870 CDD:275368
C2H2 Zn finger 878..898 CDD:275368
C2H2 Zn finger 906..926 CDD:275368
C2H2 Zn finger 934..954 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24408
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.