DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment row and CG11456

DIOPT Version :9

Sequence 1:NP_001260992.1 Gene:row / 36685 FlyBaseID:FBgn0033998 Length:1301 Species:Drosophila melanogaster
Sequence 2:NP_001262130.1 Gene:CG11456 / 40309 FlyBaseID:FBgn0037031 Length:445 Species:Drosophila melanogaster


Alignment Length:438 Identity:82/438 - (18%)
Similarity:132/438 - (30%) Gaps:203/438 - (46%)


- Green bases have known domain annotations that are detailed below.


  Fly   701 EDDLRGLEELYYGISDGTDEYHEIFPYSTPRTVHNELAKT------------------------- 740
            ::||||  .|.|        :|...|.||| :|.|:.|||                         
  Fly    21 QEDLRG--HLVY--------FHGYEPISTP-SVKNKTAKTSTKEQTAAGSNSQDKQTVVERSENS 74

  Fly   741 ------------------------------VECPI-------------CLNGDSFDSNE------ 756
                                          .|||.             |..|.||...|      
  Fly    75 EPPASELQPMPFKDFRLVLRANMLEPCSFGKECPFKFQDATKMELHCSCHKGGSFSCCECGMELP 139

  Fly   757 ---KLQTHLVSHISPEGKQHQ----------FQCLFCLEKHPTESVLAKHNQI------------ 796
               :...||       .|.||          |:|.:   |.|..:::.:|.|:            
  Fly   140 NWRRCSAHL-------WKAHQVDVDLLVCPVFECNY---KSPISALVWRHMQVHKKWRPRVLRSL 194

  Fly   797 ----------------------MHPTETKTEGSPSYY----CLICQQRHNSLHLLTAHLQKVHST 835
                                  :.|:..|.:    ||    |.||.::..:...|:.|::.||:.
  Fly   195 AAVQRRRKLKEQSAEMAAQPAALPPSSKKNK----YYAEKTCEICNRKFVNGKTLSKHVKTVHNK 255

  Fly   836 LELPYWCHSCGYRSSSHRDLVRHFYDDHKHQNFLQCPYCLDIFYFSKLGVVNQLRIEHYFMHLDE 900
            :: |:.|:.||.:::....|:.|. ..|..:..|||..|.  |......|:::.|..|       
  Fly   256 IK-PFICNVCGKKTARKASLIIHM-RQHTGEKPLQCGECK--FSTRDPSVLHKHRQRH------- 309

  Fly   901 HINKRD--PSLRCQKCSLSFLEKGDLKQHAVQHHV-----------SMTKTNRPVRLLLNNSMLI 952
              :.:|  .||:|.:|....::...||:|...:|.           |.|..|             
  Fly   310 --DSQDTRSSLKCSQCDYFCIQANALKRHMRLNHAEAYRDLCCDICSFTSIN------------- 359

  Fly   953 PPPKIRTH---HRE----------QPPFSTYKRPVFFAFLEGKTCAEC 987
             ..::|.|   ||:          ....:.:|.|.......|:..|:|
  Fly   360 -VERLRAHKQDHRQGLITNCEDSMDARAAGFKYPRKVGDKNGEISADC 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rowNP_001260992.1 C2H2 Zn finger 777..798 CDD:275368 5/54 (9%)
C2H2 Zn finger 812..833 CDD:275368 5/20 (25%)
C2H2 Zn finger 842..858 CDD:275368 4/15 (27%)
CG11456NP_001262130.1 C2H2 Zn finger 232..253 CDD:275368 5/20 (25%)
C2H2 Zn finger 261..281 CDD:275368 5/20 (25%)
C2H2 Zn finger 289..309 CDD:275368 5/21 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24408
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.