DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment row and CG1233

DIOPT Version :9

Sequence 1:NP_001260992.1 Gene:row / 36685 FlyBaseID:FBgn0033998 Length:1301 Species:Drosophila melanogaster
Sequence 2:NP_612034.1 Gene:CG1233 / 38063 FlyBaseID:FBgn0035137 Length:1129 Species:Drosophila melanogaster


Alignment Length:664 Identity:129/664 - (19%)
Similarity:207/664 - (31%) Gaps:240/664 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   436 PITDGDRNYKKRFQAILEPLSRWVHKDSTICIDLTVDKITLFSMGFKNIVQAAATDNTAKHNNSA 500
            |||...:.:.|....:..|....:|.       .|||::.|.                    |..
  Fly   525 PITTKQKIFIKNVDILKAPQRGTLHL-------RTVDELNLM--------------------NRT 562

  Fly   501 VMEYLRRIVPRMFQNTLSLLSRQMIQQFLDELVWRESFGTYALQAFNNIIIHIAEQTRVTTNETI 565
            .:|:|  |||.:....::::....:||...|                     :..|.:..| ||:
  Fly   563 EVEHL--IVPNLEPMAMTMMELPPVQQQPME---------------------VTSQLKGPT-ETL 603

  Fly   566 TQRLYQVATN-PFKDWSILPANYK----------------ETP---ANAAP-KRLKKPINDADYV 609
            .:....::.: |.:|...||.:.:                .||   |||.| ..|..  |..|.:
  Fly   604 GEFQPSISESWPSEDGYDLPEDLECWPWMEDAVPEAGLVLPTPSEVANAPPLDGLSH--NAVDLL 666

  Fly   610 V---SNKIPKKEKDRDIASSGVKRGRPPNALGTPPPQLPIKKGPGRPPGSTNQTKGDRATTSSSK 671
            |   |:......:|...|..|...|    ..||.||.:|:....|              |.|.::
  Fly   667 VKDFSHLYAAPPEDTQNAEEGTAAG----GRGTVPPLVPVTSSEG--------------TASVAQ 713

  Fly   672 SLSKSLIAKGLGKKPKEKDEKIPMVIKKEEDDLRGLEE---LY---------------------- 711
            |.:       ||..|      :|.::....:....:|:   :|                      
  Fly   714 SAA-------LGSLP------VPPLVPLAAEMNAAIEKPARIYVANNLLPAAVDPPLLGGGTSVR 765

  Fly   712 ---YG------------ISDGTDEYHE---------IFPYSTPRTV------HN---ELAKTVEC 743
               ||            :|.|.::..|         :|.:.:|.|:      ||   ...:.|.|
  Fly   766 GRPYGAKHSGGAASKRKLSLGPNQVPEGGKCLVEGCMFRFKSPVTLEYHGRCHNGSLSSNQPVVC 830

  Fly   744 PICLNGDSFDSNEKLQTHLVSHISPEGKQHQ-----FQCLFCLEKHPTESVLAKHNQIMHPTETK 803
            |.| ...:|.:...|.|||       .:.||     :.|..|..|.|..|.|...:..:|..|. 
  Fly   831 PEC-KSSNFSNWNCLHTHL-------WRTHQIDMELYSCQLCSFKTPIYSRLVNTHAKIHSEER- 886

  Fly   804 TEGSPSYYCLICQQRHNSLHLLTAHLQKVHSTLEL--------------------PYWCHSCGYR 848
                 :|.|..|.:...:...|..| :::|.|..|                    .:.|..||..
  Fly   887 -----NYKCEQCGKGFKNTKQLKNH-RRLHRTQGLGMGKQSNEQISVGPEGNPVVMHRCEDCGAA 945

  Fly   849 SSSHRDLVRHFYDDHKHQNFLQCPYCLDIFYFSKLGVVNQLRIEHYFMHLDEHINKRDPSLRCQK 913
            ....:.|..|...:...|  |:||.|.     .:.|..:.||     :||..|  :.....||..
  Fly   946 FKQKKTLREHLCKERNEQ--LECPECQ-----RRFGSKSSLR-----LHLRSH--QEHKRFRCDT 996

  Fly   914 CSLSFLEKGDLKQHAVQHHVSMTKT--NRPVRLLLNNSMLIPPPKIRTHHREQPPFST--YKRPV 974
            |.....:....::|...|..|...:  :...|.:.:.:..|   .::|.|.|| ..||  ||   
  Fly   997 CDHETSDHNAYRRHLATHKESKRYSCPHCDFRAIQSTAFRI---HLQTRHPEQ-ELSTIIYK--- 1054

  Fly   975 FFAFLEGKTCAECN 988
                     |.:||
  Fly  1055 ---------CNQCN 1059

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rowNP_001260992.1 C2H2 Zn finger 777..798 CDD:275368 6/20 (30%)
C2H2 Zn finger 812..833 CDD:275368 4/20 (20%)
C2H2 Zn finger 842..858 CDD:275368 4/15 (27%)
CG1233NP_612034.1 C2H2 Zn finger 830..852 CDD:275368 8/29 (28%)
C2H2 Zn finger 861..882 CDD:275368 6/20 (30%)
zf-H2C2_2 875..899 CDD:290200 5/29 (17%)
zf-C2H2 888..910 CDD:278523 5/22 (23%)
C2H2 Zn finger 890..910 CDD:275368 4/20 (20%)
zf-C2H2_2 893..999 CDD:289522 25/120 (21%)
C2H2 Zn finger 939..956 CDD:275368 4/16 (25%)
RPB9 966..1061 CDD:224510 28/122 (23%)
C2H2 Zn finger 966..986 CDD:275368 8/29 (28%)
C2H2 Zn finger 994..1014 CDD:275368 3/19 (16%)
C2H2 Zn finger 1022..1042 CDD:275368 2/22 (9%)
C2H2 Zn finger 1055..1075 CDD:275368 3/5 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24408
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.