DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment row and Zfp787

DIOPT Version :9

Sequence 1:NP_001260992.1 Gene:row / 36685 FlyBaseID:FBgn0033998 Length:1301 Species:Drosophila melanogaster
Sequence 2:NP_001102374.1 Gene:Zfp787 / 365176 RGDID:1310536 Length:381 Species:Rattus norvegicus


Alignment Length:522 Identity:98/522 - (18%)
Similarity:146/522 - (27%) Gaps:209/522 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   591 PANAAPKRLKKPINDADYVVSNKIPKKEKDRDIASSGVKRGRPPNALGTPPPQLPIKKGPGRPPG 655
            |.::..:::....|..|.::.:       |.|:.|      .|||.| :||...|   .||.|| 
  Rat    12 PLDSEDQQMASHENPVDILIMD-------DDDVPS------WPPNKL-SPPQSAP---PPGPPP- 58

  Fly   656 STNQTKGDRATTSSSKSLSKSLIAKGLGKKPKEKDEKIPMVIKKEEDDLRGLEELYYGISDGTDE 720
                                         :|:..                               
  Rat    59 -----------------------------RPRPP------------------------------- 63

  Fly   721 YHEIFPYSTPRTVHNELAKTVECPICLNGDSFDSNEKLQTHLVSHISPEGKQHQFQCLFCLEKHP 785
                .||.              |..|  |.||....||..|..:|..    :....|..|.:...
  Rat    64 ----APYI--------------CTEC--GKSFSHWSKLTRHQRTHTG----ERPNACTDCGKTFS 104

  Fly   786 TESVLAKHNQIMHPTETKTEGSPSYYCLICQQRHNSLHLLTAHLQKVHSTLELPYWCHSCGYRSS 850
            ..|.|.:|.:| |      .|...|.|..|.:|.:....|..| |::| |.|.||.|..||...:
  Rat   105 QSSHLVQHRRI-H------TGEKPYACSECGKRFSWSSNLMQH-QRIH-TGEKPYTCPDCGRSFT 160

  Fly   851 SHRDLVRHFYDDHKHQNFLQCPYCLDIFYFSKLGVVNQLRIEHYFMHLDEHINKRDPSLRCQKCS 915
            ..:.|.:| ...|.......||.|...|...| .:...||:         |.....|.:..:..:
  Rat   161 QSKSLAKH-RRSHSGLKPFVCPRCGRGFSQPK-SLARHLRL---------HPELSGPGVAAKVLA 214

  Fly   916 LSFLEKGDLKQHAVQHHVSMTKTNRPVRLLLNNS---MLIPPP----------------KIRTHH 961
            .| :.:....:.|       |..:..:.:.:.:.   :::.||                ...|..
  Rat   215 AS-VRRAKAPEEA-------TAADGEIAIPVGDGEGIIVVGPPGDGAAAAAALAGVGTRATGTRS 271

  Fly   962 REQPPFSTYKRPVFFAFLEGKTCAECNTDFASEETHYTGWL-HCVKCNYQTCCERAQFRHG---- 1021
            |..|....|            .|.||...|.    |..|.| |          :|||  ||    
  Rat   272 RRAPAPKPY------------VCIECGKGFG----HGAGLLAH----------QRAQ--HGDGLG 308

  Fly  1022 -----------VECNGNFVDAMEVNMPQEMHCI--------CGFA--------TGNGNKMAQHLA 1059
                       |||...||....:...:::|.:        ||.:        .|....:|...|
  Rat   309 AVGSEEPAHICVECGEGFVQGAALRRHKKIHAVGAPSVCSSCGQSFYRAGGEDDGEDQSVAARCA 373

  Fly  1060 NC 1061
            .|
  Rat   374 EC 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rowNP_001260992.1 C2H2 Zn finger 777..798 CDD:275368 6/20 (30%)
C2H2 Zn finger 812..833 CDD:275368 6/20 (30%)
C2H2 Zn finger 842..858 CDD:275368 4/15 (27%)
Zfp787NP_001102374.1 zf-C2H2 66..88 CDD:395048 9/37 (24%)
C2H2 Zn finger 68..88 CDD:275368 8/21 (38%)
COG5048 <93..200 CDD:227381 33/126 (26%)
C2H2 Zn finger 96..116 CDD:275368 6/20 (30%)
C2H2 Zn finger 124..144 CDD:275368 6/20 (30%)
C2H2 Zn finger 152..172 CDD:275368 5/20 (25%)
C2H2 Zn finger 180..200 CDD:275368 7/29 (24%)
C2H2 Zn finger 282..302 CDD:275368 9/33 (27%)
C2H2 Zn finger 319..339 CDD:275368 5/19 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24408
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.