DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment row and Pogz

DIOPT Version :9

Sequence 1:NP_001260992.1 Gene:row / 36685 FlyBaseID:FBgn0033998 Length:1301 Species:Drosophila melanogaster
Sequence 2:XP_008759517.1 Gene:Pogz / 310658 RGDID:1309980 Length:1410 Species:Rattus norvegicus


Alignment Length:622 Identity:148/622 - (23%)
Similarity:223/622 - (35%) Gaps:163/622 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   616 KKEKDRDIASSGVKRGRPPNALGTPPPQLPIKKGPGRP--PGSTNQTKGDRATTSSSKSLSKSLI 678
            ||.|..|...|.....:|    .:|....|:...|...  |..:..||....:.|:..::...||
  Rat   403 KKGKSLDAEPSVPSAAKP----ASPEKTAPVTSTPSSTPIPALSPPTKVPEPSESAGDTVQTKLI 463

  Fly   679 AKGLGKKPKEKDEKIPMVIKKEEDDLRGLEELYYGISDGTDEYHEIFPYSTPRTVHNELAKTVEC 743
                            |::          ::.|||...|.......||         ::|.:..|
  Rat   464 ----------------MLV----------DDFYYGRDGGKAAQLTSFP---------KVATSFRC 493

  Fly   744 PICLNGDSFDSNEKLQTHLVSHISPEGKQHQFQ----CLFCLEKHPTESVLAKHNQIMH-PTETK 803
            |.|..  ...:|.:...|:..|:..:.:..:..    |..|..:..|...|..|.:.:| |.|:.
  Rat   494 PHCTK--RLKNNIRFMNHMKHHVELDQQNGEVDGHTICQHCYRQFSTPFQLQCHLENVHSPYEST 556

  Fly   804 TEGSPSYYCLICQQRHNSLHLLTAHLQKVHSTLELPYWCHSCGYRSSSHRDLVRHFYDDHKHQNF 868
            |:      |.||:....|..|...|::..|...|:||.|..|.||||.:.::..||...|:....
  Rat   557 TK------CKICEWAFESEPLFLQHMKDTHKPGEMPYVCQVCQYRSSLYSEVDVHFRMIHEDTRH 615

  Fly   869 LQCPYCLDIFYFSKLGVVNQLRIEHYFMHLDEHINKRDPSLRCQKCSLSFLEKGDLKQHAVQHHV 933
            |.|||||.:|   |.|...|   :||..|...::      ..|.||.|.||...|..:|.:||| 
  Rat   616 LLCPYCLKVF---KNGNAFQ---QHYMRHQKRNV------YHCNKCRLQFLFAKDKIEHKLQHH- 667

  Fly   934 SMTKTNRPVRLLLNNSMLIPPPKIRTH-HREQP---PFSTYKR-----------------PVF-- 975
               ||.|..:.|   ..|.|..|:... .|.||   |.|:...                 |||  
  Rat   668 ---KTFRKPKQL---EGLKPGTKVTIRASRGQPRTVPVSSNDAPSGALQEAAPLTSADPLPVFLY 726

  Fly   976 --------------FAFLEGKTCAECNTDFASEETHYTGWLHCVKCNYQTCCERAQFRHGVECN- 1025
                          .:.:..:||.||:.:......|:..::||..|.|.|||.||...|.:..: 
  Rat   727 PPVQRNVQKRAVRKMSVMGRQTCLECSFEIPDFPNHFPTYVHCSLCRYSTCCSRAYANHMINNHV 791

  Fly  1026 -----------GNFVDAMEVNMPQEMHCI-CGFATGNGNKMAQHL--------ANC---GLS-TC 1066
                       .|||..:      ::.|. |.|||..|:.||:||        :|.   ||| ..
  Rat   792 PRKSPKYLALFKNFVSGI------KLACTSCTFATSVGDAMAKHLVFNPSHRSSNILPRGLSWMS 850

  Fly  1067 YPSLEAASENAVKRNML----------DMLGLVRRDGETSGEGADIS-ETADDVADQSSDMLPPQ 1120
            |..|....|..:.|:|.          :....|:..|.||.|..::: .....:...:|...||.
  Rat   851 YSRLGQTPERVLDRSMKNTYLPPPLLPNKAATVKPVGATSAEPQELAGPVLQALPSPASTATPPA 915

  Fly  1121 EDHHLQ---------QHHQQVGHQQQMQGQP--NEPQ 1146
            ...|.|         :..:.:...:|.:|.|  .||:
  Rat   916 TPTHPQPSALPPLATEGTECLNVNEQEEGSPVTQEPE 952

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rowNP_001260992.1 C2H2 Zn finger 777..798 CDD:275368 5/20 (25%)
C2H2 Zn finger 812..833 CDD:275368 6/20 (30%)
C2H2 Zn finger 842..858 CDD:275368 6/15 (40%)
PogzXP_008759517.1 PHA03247 264..>458 CDD:223021 13/58 (22%)
C2H2 Zn finger 493..526 CDD:275371 6/34 (18%)
C2H2 Zn finger 529..550 CDD:275368 5/20 (25%)
C2H2 Zn finger 559..580 CDD:275368 6/20 (30%)
C2H2 Zn finger 589..610 CDD:275368 8/20 (40%)
C2H2 Zn finger 618..638 CDD:275368 11/25 (44%)
tatB <872..929 CDD:166942 10/56 (18%)
CENPB 1018..1079 CDD:197828
rve 1159..>1270 CDD:419726
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm45293
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1818
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.