DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment row and ztf-28

DIOPT Version :9

Sequence 1:NP_001260992.1 Gene:row / 36685 FlyBaseID:FBgn0033998 Length:1301 Species:Drosophila melanogaster
Sequence 2:NP_503566.1 Gene:ztf-28 / 185364 WormBaseID:WBGene00018099 Length:272 Species:Caenorhabditis elegans


Alignment Length:113 Identity:24/113 - (21%)
Similarity:47/113 - (41%) Gaps:13/113 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   750 DSFDSNEKLQTHLV----SHISPEGKQHQFQCLFCLEKHPTESVLAKHNQIMHPTETKTEGSPSY 810
            |.|::....::.|:    |.:.....:..|.||.|.:.....:.|.:|.:::|        |..|
 Worm    11 DRFETEFAEKSSLLRKEESELKRPDLRGDFLCLSCGQNFKHGASLNRHRKLVH--------SDEY 67

  Fly   811 YCLICQQRHNSLHLLTAHLQKVHSTLELPYWCHSCGYRSSSHRDLVRH 858
            .|::|.::......:..|::..| .|...|.|..|.:..|:.:.|..|
 Worm    68 TCMLCARKLYLKETVRDHMRNEH-YLGQVYTCGCCNWTFSNKKALTEH 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rowNP_001260992.1 C2H2 Zn finger 777..798 CDD:275368 5/20 (25%)
C2H2 Zn finger 812..833 CDD:275368 3/20 (15%)
C2H2 Zn finger 842..858 CDD:275368 4/15 (27%)
ztf-28NP_503566.1 COG5236 <14..>114 CDD:227561 21/108 (19%)
C2H2 Zn finger 42..63 CDD:275368 5/20 (25%)
C2H2 Zn finger 69..90 CDD:275368 3/20 (15%)
C2H2 Zn finger 98..114 CDD:275368 4/15 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24408
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.