Sequence 1: | NP_001260992.1 | Gene: | row / 36685 | FlyBaseID: | FBgn0033998 | Length: | 1301 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_504371.1 | Gene: | C04F5.9 / 178899 | WormBaseID: | WBGene00015451 | Length: | 534 | Species: | Caenorhabditis elegans |
Alignment Length: | 302 | Identity: | 63/302 - (20%) |
---|---|---|---|
Similarity: | 88/302 - (29%) | Gaps: | 109/302 - (36%) |
- Green bases have known domain annotations that are detailed below.
Fly 737 LAKTVECPICLNGDSFDSNEKLQTHLVSHISPEGKQHQFQCLFC---------LEKHPTESVLAK 792
Fly 793 HNQIMHPTETK---------------------TEGSP-------SY---------YCLICQ---- 816
Fly 817 ----QRHNSLHLLTAHLQKVHSTLELPYWCHSCG----YRSSSHR-------DLVRHFYDDHKHQ 866
Fly 867 NFLQCPYCLDIFYFSKLGVVNQLRI-----------------------EHYFMH---------LD 899
Fly 900 EHINKRDPSLRCQKCSLSFLEKGDLKQHAVQHHVSMTKTNRP 941 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
row | NP_001260992.1 | C2H2 Zn finger | 777..798 | CDD:275368 | 7/29 (24%) |
C2H2 Zn finger | 812..833 | CDD:275368 | 5/28 (18%) | ||
C2H2 Zn finger | 842..858 | CDD:275368 | 5/26 (19%) | ||
C04F5.9 | NP_504371.1 | C2H2 Zn finger | 7..27 | CDD:275368 | 11/21 (52%) |
C2H2 Zn finger | 36..54 | CDD:275368 | 4/17 (24%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR24408 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |