DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11807 and Stk11ip

DIOPT Version :9

Sequence 1:NP_001260990.1 Gene:CG11807 / 36683 FlyBaseID:FBgn0033996 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_082162.3 Gene:Stk11ip / 71728 MGIID:1918978 Length:1072 Species:Mus musculus


Alignment Length:367 Identity:87/367 - (23%)
Similarity:145/367 - (39%) Gaps:85/367 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 LAKLFNESGDALLSSKKEYNLSALEVYAISERLSL---PCPPSLDRGGKYDF----SHVLDFCTQ 183
            ||.|..|||||:||.....:|....:..::....|   |..|     |:..|    ||..|    
Mouse    13 LAGLLRESGDAVLSGCSTLSLLTATLQQLNRVFELYLGPWGP-----GQTGFVALPSHPAD---- 68

  Fly   184 LVALVVTPVKDNASYAQDYNTVDVPIDRSNI----IPNRLSFNLNAFRNLKTLKFSALSTENIVD 244
                  :||.....:..|.....:.:...:|    :|..:  .:..|::|:.|:...:...::..
Mouse    69 ------SPVILQLQFLFDVLQKTLSLKLVHIPGVGLPGPI--KIFPFKSLRQLELRGVPIHSLCG 125

  Fly   245 IELLKPTLQTICVHNTTIQNINQVLLCDNLHKHCDVPSLLPETILASPSGSGPSTSNGSALVSAD 309
            :..:...|::: |.|.:||.:.::|                             ::.|..|.||.
Mouse   126 LRGIYSQLESL-VCNRSIQALEELL-----------------------------SACGGDLCSAL 160

  Fly   310 AWQEITELDLTGNLLTQIDGSVRTAPKLRRLILDQNRIRTVQN-LAELPQLQLLSLSGNLIAECV 373
            .|..:...|.:.|.|..:|.|:|....||.|.|..|.::..:. |.:|.:|..|.:|.|      
Mouse   161 PWLALLSADFSYNALRSLDSSLRLLSALRFLNLSHNHLQDCKGFLMDLCELYHLDISYN------ 219

  Fly   374 DWHLTM--------GNLVTLKLAQNKIKTLSGLRKLLSLVNLDLSSNQIEELDEVNHVANLPLLE 430
              ||.:        ..|.||.|..|::::|.||.:|.:|.:||::.|.:|...|:..:..|..|.
Mouse   220 --HLRLVPRVGPSGAALGTLILRANELRSLQGLEQLKNLRHLDVAYNLLEGHTELAPLWLLAELR 282

  Fly   431 TLRLTGNPL-------AGSVDYRSRVLARFHERAAEISLDNE 465
            .|.|.||||       |.:..|.|   .|..:.|....||.:
Mouse   283 KLYLEGNPLWFHPAHRAATAQYLS---PRARDAAHGFLLDGK 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11807NP_001260990.1 PX_IRAS 8..126 CDD:132785 87/367 (24%)
leucine-rich repeat 315..336 CDD:275380 6/20 (30%)
LRR_8 335..414 CDD:290566 26/87 (30%)
leucine-rich repeat 337..381 CDD:275380 13/52 (25%)
LRR_4 381..422 CDD:289563 15/40 (38%)
leucine-rich repeat 382..403 CDD:275380 9/20 (45%)
leucine-rich repeat 404..428 CDD:275380 7/23 (30%)
Stk11ipNP_082162.3 LIP1 4..94 CDD:292526 22/95 (23%)
LRR 1 109..130 2/20 (10%)
LRR 2 132..152 6/49 (12%)
LRR 3 164..185 6/20 (30%)
LRR 4 187..209 6/21 (29%)
LRR 5 210..231 6/28 (21%)
leucine-rich repeat 211..233 CDD:275378 6/29 (21%)
LRR 6 233..254 8/20 (40%)
LRR_4 234..274 CDD:289563 15/39 (38%)
leucine-rich repeat 234..255 CDD:275378 9/20 (45%)
LRR_8 236..291 CDD:290566 20/54 (37%)
LRR 7 255..276 6/20 (30%)
leucine-rich repeat 256..280 CDD:275378 7/23 (30%)
LRR 8 280..301 8/20 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 333..366
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 441..522
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 741..762
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 967..993
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1859
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3315
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.